Leptospira biflexa serovar Patoc Patoc 1 Ames uid58511

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189909832|ref|YP_001961387.1| rhodanese-like sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MVPEIDVVSLKKRLDARAEGKDDFFVLDVRNPNEQQIALVPGTDKLIPVSELAARIDEIKSQIDKEILVYCRSGGRSGMA
    CGILAQAGFKSYKNVAGGTLAYSDLVDPNMQKY

    >gi|189909842|ref|YP_001961397.1| polyketide biosynthesis dithiol-disulfide isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSTNSEVFPIDIVSDVACPWCYVGKKKLEKALSIVGNTINPEVRWRPFQLSPEIPEEGIDYKLHLTQKFGSLDRLDGAWK
    RLSEIGKDVGINFQFQNIPKATNTLALHALVAALPSLEEQQKLVERFFAANFEEALDLTDKEVVWKVTEPVYKDRNKFDA
    IYSDSNLKQEIQQEIQYYHQNGISGVPYFIIGGKYAVSGAQDTSVFVEVIETVIKERESENKGQ

    >gi|189909898|ref|YP_001961453.1| 4-carboxymuconolactone decarboxylase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MAENHYYNAKDLGKFGEIGRTNPALADKFFGYYNAVMAEGALSEREKALIALAVAHALKCPYCIDAYTTTSLQKGADEAQ
    MNEAVHVAAAMAAGINLVHSVQMQNKIDELSF

    >gi|189909968|ref|YP_001961523.1| hypothetical protein LBF_0399 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MPSLSFPSFPLVEATYTSLPNSFFQVTKPTPVTSPEVLFWNDALALEFQFSHWKKQEEATARFFSGSILPEGIEPFAQAY
    AGHQFGHFTMLGDGRTIVMGEFKNKNGERFDFQWKGSGRTKYSRNGDGRATISAMVREYIMSEAMAGLRIPTTRSLAVVK
    TGEAVLREDPQEGAVLTRVAKSHIRVGTFEYAYQALSLEELEALFLYTARRHAPDVLNTENPALAFLEFVMRRQVSLITN
    WMRVGFIHGVMNTDNMSIAGETIDYGPCAFMNGFSAKRVFSSIDVNGRYAFSNQVGIAQWNLACLTNSLLPLLDPNQETA
    IALAKTKLNELESWFHESYIRMLGEKIGFPNLTEKDLLLLQSLYQWMQDTEADFTNTFLVLEGVYSPKDTIYNDIRWKDW
    VKLWKEEKTKQGIRDEDAISLMQKTNPSFVPRNHLVEMALANVHQGNTSVVDQFIERSLSPYKREIGYDYGDEVPMGGDA
    NYQTF
    CGT

    >gi|189909998|ref|YP_001961553.1| peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MLEVGKKAPNFKSVNQNGESVKLADLTGKNGIVVYFYPRDMTPGCTTEACDFRDNFSRLKKFGYNVVGISKDNPKSHTKF
    IEKQELNFDLISDESGEICEAYGVWREKVFMGRKGMGIVRSTFLLDSSLKIKKIYDSVKVKGHVEEIIKDIQEIQGK

    >gi|189910169|ref|YP_001961724.1| glutathione peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MQRKVLFAIFLFVSFSLIAGGKKMTFHDLKTITIQGKEISLGEYKGHPVLVVNVASKCGYTPQYEGLEKLHLAYKDKGLK
    VVGFPSNDFGGQEPGTEAQIAEFCKLNFGVSFDLMKKTKVLGNDKDPVYQFLTENAKEKGDVKWNFEKFLIDKNGNIVNR
    FPSSTKPESVELKQAIESIL

    >gi|189910324|ref|YP_001961879.1| glutathione peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MAEEFYNIKVKRGSEEIPMEQFKDKVLLIVNTASQCGFTPQYKGLQETYDRWKGKGLEILAFPCNQFGEQEPGSDADIKL
    FCEKTFSTTFPIFSKLEVNGPNTDALYMHLKKNAPGIFGSLDIKWNFTKFLVDKNGKVVKRYAPITKPEAIEKDIEKLVQ
    G

    >gi|189910400|ref|YP_001961955.1| protein-disulfide isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNRKNLAIGGLVVGVLGLLFSFLLAVEYFGIGTDNVAGAACSALGGGDSCLKVAESSYSAIPGVPFLGNIPIALLGFGFY
    GLLVYTFYLIYKSTNSEEISKLISLVLPVLILGFIFDLILFGISVGIIGTICQLCFITYIVTISLLAIVFLLWKTEGKPK
    LNIPASIKDGYATFGLVFFFSFSVGFASSKMWVKGESSNTLATSRGMDSKEIQTKIVSYFQEPTLGINVSGSPFIGKKDA
    PITIVKYADYN
    CGHCLHTSHILHTVLSEYDGMVKVVYKNFPLDGSCNRLMQQPRPGASSCVAAMAAICADKQGKFEPMYR
    GLYDNLEKGVAHSGASVVNLGNLIGLNVNSLKACMASKEAQNQLNAEIDEAEKLNIQSTPSLYINDRRIESGTPNPVFLK
    TLLEQIIQKM

    >gi|189910459|ref|YP_001962014.1| thioredoxin domain-containing protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MFRFSLLLISFLFGSILSADSNWGNSIQKGFETAKQEKKFIIVDVFADWCTYCMVLEKEIFPDPEVSRILDQFVRVRLDG
    EEFPNLRKKYNVEGYPTILFLDGEGNFVTKITGLATKEDILILSKRILQEPNLESFLKTEMRKDKENPNLHFRLGLLYFQ
    SKEYTKAEEQFISSIQKSKQLPIVKENSYFNLNLIRSVNGPKELAVTSWKEFIQLYPNSKRLITAKLYYGISLKESGDFK
    HAKTILKEIQPKLESESDQLICKETLEQIEKGF

    >gi|189910573|ref|YP_001962128.1| dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MEQYDIIVIGAGPGGYVAAVRAAQLGKKVAIIEKRKTLGGTCLNVGCIPSKALLDSSEEFHKTKHKLADHGISVKDVKID
    IAKMMARKDKVVSEVTSGVDYLMKKNKITRYLGQASFVSKTEVSITADDGKKESISGTNIIIATGSTPIEIPPLPVDGKN
    IVTSDHAIGFDSVPEHLIIVGAGVIGLELGSVWLRLGAKVTVVELMPRLFGTADQAMASLAERLLTQQGINFLFETKVHG
    AKVKGKKVEVEIEGKDGKKSVLEGDKVLVSIGRRPNTDGLGAKEIGIEMTDRGRVKVEPNKFQTNIPNIYAIGDVVDGPM
    LAHKAEDEGIAVAELICGKYGHVNYKAIPWIVYTWPEVAWVGLGEEELKAKGIEYKVGKYMFKPNARAKAMNETDGQVKV
    LADKKTDKLLGVYIVGPRASDMIAEAAIAFEFGASAEDIARSTHAHPTLSEVLREAAMDADAKWSIHS

    >gi|189910650|ref|YP_001962205.1| oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MENNFKSWMAQPISKIFIGTNLVFALLFFVSVPSFVKEYITQDAVSIGGKKYDLSDVKNSSPIAYSKFQSEYKSLLKNTF
    GEFAQDKLFELVAKDRNIKPSEVLNEGLILREPSEEDIINVYMSNKAQLGGKSLAETREKIVGFLKNQQEQEHSRNKYRE
    IITKYPVDFLIKEPEAIRVTVDEKNNPSIGPKDAKVTVIEFSDFE
    CPFCKRSQDVNNQLREKYKGQIRWVFRDFPLPFHQ
    DAMYAHMAANCSIEEGKYWDVFNVLFENSGNLSKSKVDEFVLKTGLSKEKYQSCMKDQSKLKSEIEADIQDGQKVGVSGT
    PAFFINGIFVSGALPFENFDEIIQKELKQ

    >gi|189910663|ref|YP_001962218.1| thiol-disulfide isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MMKIWKQLPYGWKVFFAFVFFFSATLGFAYFKARDTNPSVPIEALATTPTEANSWKGHPKVVYFWATWCTVCKAYTPILE
    ANLKFLPKETLFLSVLESEDSEETKEILSQLSTDSPYPIYTADYRMLKEWRISAYPTTLFLNREGKVIFADSGILSPLGF
    WLRSFLLRFF

    >gi|189910678|ref|YP_001962233.1| hypothetical protein LBF_1131 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MENKNWKEILTPLQYQVTREKGTERPFTGEYYAHKEKGTYLCVCCGEALFSSETKYESGSGWPSYYEPVRSDAVSTETDR
    SHGMTRTEIQCQNCGAHLGHVFPDGPKPTGLRY
    CVNSASLKFQKSE

    >gi|189910849|ref|YP_001962404.1| peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MPQVTSHAPDFKATAVIGDSFKEIKLSDYKGKWVVLFFYPLDFTFVCPTEIIEYDAKLEDFKKIGAEVLGVSVDSEFSHL
    AWKKTPKKEGGIGEIKYPLIADKTKEIAKSFGVLIESGPDAGVALRGTFIIDPQGIIRQATVNDLPVGRNIEEALRLIKA
    FQFVEKHGEVCPANWDEGKKTMKADPTGSKAYFASVN

    >gi|189911120|ref|YP_001962675.1| thiol-disulfide isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNPKMKTIFNRLISSRIYLLVLLTLFFCKPDVGKVDFYPDPLPTVSGSSESMNEWKGKVIVLDFWATWCEPCAKAVPTIN
    EWKKSVSDTDFVFRGINTDTTEPLEKIKDDMARLKMTYPTLLDKDWKMTDFYKVEGIPCVLVFDRNGKIVYRQYGLEKED
    LTGLVIRSHVWASSELP

    >gi|189911169|ref|YP_001962724.1| flavoprotein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MTTSGFRNPSVVVIGAGMTGILLAIELEKAGITDITILEKKHDLGGTWRENTYPGVACDIPAHMYTYSFAPNPEWSHRFA
    HGDEIQAYFKRVSDEYKVTPKIHFNEAVTESSYQNAKWTIKTSKDKTYVSDFLISATGILHHPAKPNIPGLERFQGKCFH
    TAEWDHSVPLEGKRIGVIGTGSTAAQVIPEVMKLGKKVSVFQRTPQWIVKVPDTTYTEEDKKKWRKEPNLLKRFHKWYTF
    AVEQTFSKAVIGKKIPHMLMSFLCKRNLRTSVKDPELRKKLTPNYRVGCKRVIVNSTFYDAIQKPNADLVTEGIEKITEK
    GVVTKDGKLHELDVLVLATGFHPFHFMRPMNLTGENGISIETAWKKKVQAYRSLFIPHFPNFVLMLGPNTPIGNFSVIAM
    SEVQTKYVLKIIEDWRRGKFNSIQATEEALHRFAAYLKKGMAGTVWLGGCQSWYLDPDGDPAMWPYTWKQWEKEMKTPDY
    NDFSLTTQ

    >gi|189911260|ref|YP_001962815.1| hypothetical protein LBF_1730 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MANLSKKPNRLVHEKSPYLLQHAHNPVDWFPWGTEAFEKAKKEDKIILLSIGYSTCHWCHVMERESFEDISTAEVLNRDF
    VCIKLDREERPDIDKIYMDALHAMGTQGGWPLNMFLTPEKEPILGGTYFPPENRYGKRSFKEVLRLVTKAWKEQKGELLQ
    AANELSNYLRENQTRTNDGKVPGTEILVQNFNRYWQVYDQEFFGFKTNTINKFPPSMALIFLLDYYSIHKDNRALEMAYN
    TGYAMKSGGIYDQVGGGIYRYATDHEWLVPHFEKMLYDNALYVEFLAKLYQITGEIFFLEALMEIISYIQRDMRLDIGGI
    ASAEDADSEGEEGKFYLWKESEILSELTEEEVIGYWNVTEEGNFENNQNILNVAIKGKNPYQEGIHFKDGFKIKLERSKE
    ILYQLRNQRIRPLRDDKILTSWNCLWIRALLASFEATGDPLFLNQSKTIYEFLFTYLVKEDGSVYRRFREGETKFFGTLP
    DYSELIWVSFRLFQLVGDKQYFLQGLQIFKYVETHFLSDMGPYFESAAGDEELIARTIDGYDGVEPSGNSTILHIFYFLH
    SLGFLHADILKKANAIFSYFLPELTQNSLSYPSMLSAFQKFQTPSKVVIVLHRNQSEEKMNEIRKNLSSLNDPTLIWLVL
    SEDVSRSLELDLGILNGRDAGDGVRYYVCQNFQCELPTDTWEEAFHLISK

    >gi|189911377|ref|YP_001962932.1| dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKEYDILVIGAGAGTKLVTPPSQIGKRVAVFERETPGGTCLNRGCIPSKMVIFPSELLRLKEESERFGIQYPSPPIYDVN
    SIFQRVNERVKADSDSIPIAYEKNPNIDYIPKNVWFKASKIITDGENDYTAKHILVVTGTRPNLPEIPGLKDTPFWTSRE
    ALSPDEFPKSLLIIGAGFISLELGAAYQAYGAQVTGITRGEVLRQVDFEIKEELKKHLPFPIHTGFHMEQVEFRNGEFRV
    SGTNKEGQTQTFVAEKLLVATGIKPNTEDLKLENTKIQCNPDGYILVDETLQTNEEGVYAFGDVIGRYFFRHSANFEGEY
    LFHHLYEGGEKKPIVYPPMPEAIFTHPQIASVGKTEDELIQEKIPYYKGLNPYRSSATGMARLSEVGFVKVLVSKETEEV
    LGAHVIGEEAANLLHQIVMGMYLKAKLDDYLGMIYIHPAISEITRNAFRKVREQKLKEIKS

    >gi|189911378|ref|YP_001962933.1| sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKKFLFNRYDKETLKKKVLEDKRERRVISFYRYVKITDPIAFRDVLYDSLEDLGVLGRIYLANEGINAQFSIPIGNYDAL
    RKFVDFIPELKNIYFNDAVEDKKESFIKLAIKVRKKIVADGLDDSQFDPSNVGTHLSPLEFHQALEEDGVIVVDLRNNYE
    SEVGHFENAILPDVGTFREELPLVEQILEKDKDKKILLY
    CTGGIRCEKASAYLKYKGFEKVHQLQGGIINYAKAVTDHGL
    KSKFKGKNFVFDDRLGERITDDVLTVCYTCGNPSDRHTNCANLGCHVLIVQCESCSEKLLGTCSEECKEIVSLPEETQKK
    LRQEQRKQQKYPTHHLTRKLVGK

    >gi|189911382|ref|YP_001962937.1| glutathione transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MTKPTLVSFKLCPYVQRSVINLLEKKVEYEIKYIDLANKPDWFLKISPFGRVPVLVVGEEVLFESAVINEYLDETNLPSL
    HPKDPLLKAKHRAWAEFASALLVDQYGWTMSKEESDSNKKKEEILSKFKILESILPEPKNGTLFFAGETKHLVDTAYAPF
    FMRMEFLKNKGVEFDLVSGFPKVQTWSDTLLSLPSVKNSVLPEVPKEYIEFIKAHNSWMGGKL

    >gi|189911384|ref|YP_001962939.1| glutaredoxin-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MEQELKDKIESLIKSEKVFLFMKGTPEMPQCGFSAGVVSTLKQQGISFGSFNVLSDMNIREGIKEYTNWPTIPQLYINGE
    FVGGHDITVQMAQSGELKKKIG

    >gi|189911385|ref|YP_001962940.1| glutaredoxin-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MIRLYQYDSCPYCYRVRQSISALGLVEGKDYELVEARNGTAGREEVIRLGGISQVPFLVDGGVKMYESLDIIDYLEKKFS


    >gi|189911649|ref|YP_001963204.1| copper chaperone [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MYKIFNDFRIQVSAGFLLAISSSLCCVSPIVGVIGGFSGIASTFSWLEPYRSFLIILSMVIFSLLWYNLITKSKKSDLDC
    DCERSIFNRFFYSKIYLTFVTILSLFLFLFPNYSSILKSVNEVKGKLESEHLVVAEFVISGMTCVGCEYSVNTALVELTG
    VLKVTSDYKKGVTQIVYDKRKVGIQEFKDIIQNKVGYKVINIKGERKWK

    >gi|189911691|ref|YP_001963246.1| copper chaperone [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MLSHIYSKENIFGRIAMYKIFNDFRIQVSAGFLLAISSSLCCVSPIVGVIGGFSGIASTFSWLEPYRSFLIILSMVIFSL
    LWYNLITKSKKSDLDCDCERSIFNRFFYSKIYLTFVTILSLFLFLFPNYSSILKSVNEVKGKLESEHLVVAEFVISGMTC
    VGCEYSVNTALVELTGVLKVTSDYKKGVTQIVYDKRKVGIQEFKDIIQNKVGYKVINIKGERKWK

    >gi|189911721|ref|YP_001963276.1| glutathione transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MIEFYEFKTSGNCYKIKLMLSLLDLKFESRFINPIDKEHKSEQFLELNPFGQVPVLKDGSIILRDSQAILVYLARKYGKE
    HWFPIEPSDMAEIVSWLSIATNEVARGPALLRMHYLLGRKIDLEEAVSTTDQILSILDNMLSSRDWLVNQEVSIADIAIY
    PYLALSHQGNIDLSKYTNIVNWMSRVEHLPGYVQFTQ

    >gi|189911749|ref|YP_001963304.1| thioredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MALTEINDANFKAETANGVVLVDCWAEWCGPCRMVAPVLDELSQEMADIKITKLNVDFNQKTAQELGIQSIPTLLLYKDG
    VLVDKAIGALPKPQIKKFIENHK

    >gi|189911805|ref|YP_001963360.1| thioredoxin-disulfide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNHKVVIIGSGPAGHTAAIYAARANLNPVMYEGFMAGGVAAGGQLTTTTEVENFPGFPEGIDGTKLTQLFREQSAKYGTT
    IHTQTITKVDFSKRPFTIWSDDEEIKADSIIIATGATAKRMFVKGEDVFWQRGISA
    CAVCDGALPIYRNKALAVVGGGDS
    AVEEANHLTKFASKVYLVVRRDQLRASQIMQKRAMEHPKIEILWNQTVVEAKGGAGGLTSIVLESTKDKTQKDLEVGGLF
    YAIGHVPNTEIFKGQLNLDETGYIITKPGTTQTNVEGVFAAGDVQDKVYRQAITAAGSGCMAALEAERWLEGH

    >gi|189911987|ref|YP_001963542.1| glutaredoxin family protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNLQIFGTKKCKDSKKAQLFFQERRIPFQFINLQEKEMSKGELRSILGSVKLDDLIDTESKVYEDKNLKYMLYDKEEALL
    TNPLLFKTPIVRDGKRATIGFVPEIWKQWINDSKK

    >gi|189911995|ref|YP_001963550.1| thiosulfate sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKIQRSYGIYLFAIALFWALWLQLSAGPKKQGLNPKTHTWFLSPKEALDLPEFKTIDTRSFPSRLLEKLPMSQVLGWEDL
    SLKENPFRGKLQKEEDIQKKLLSLGFHLEDLILVLGDGASGWGEEGRIVWSLREVGFSNVFWFDGNVRSLKEVLVVRKQR
    ASHPIEKDTIQIKTNITKEEISKQLQNNFYQILDTRETREFSGSTPYGESRGGHIPGAKSFYYQNLFDAKGSIKSKQEVE
    TILSQLGITKTKPIIAY
    CTGGVRSAFVVGILRSYGYNAYNYSGSMWEWSFYPDLPMEK

    >gi|189912015|ref|YP_001963570.1| rhodanese-like sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MIQKWIQTLTAFLLLSFSVSCVEKKEDKNTLLAALLYLAANQIKVNSATDLVNESADDYNQNNWGLITPQTLARFVTNWP
    ANKPSHITGNLIILQTDDANRVAGGAASAYVAENPGQGVYVYLLDDYKPADLPSGGFRFNQTRDTGLFTNSVRYQANGQF
    VDDWLKTFGINLSKDLVVFAVGTGNGISGGAYPGKAVGAGAVQDITRGVYWLRYWGAEIKNLAILNGNLNKKATGAGIPL
    STSRSGINLERNGGFSVKQLRVDNTVLTLGLEDIYEIAKTGGNANLSGLTAKQQIIDARPATQYDGSADGLNVPRNLLVA
    NPASQAYITTSYQSSGAPSASAGNQTFVPFEGSIKSSKTFPWSDLLKDNADGYEYLDKAALKTLFNTTRAVYTPGATIVS
    Q
    CRTNFEAQVNGFASLNILGYPTVYYDGSLVEWTALVAGHGTSSINQIPTDFKWRTDNTSVSNFLWYNNATHVVRPNVNL
    TATTTKKFIQEDKAYKY

    >gi|189912027|ref|YP_001963582.1| thioredoxin reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MESLQKADITIIGGSYSGLSAALTLVRSLRNVLVIDSERPCNQNTPFSHNFITHDGIKPSEIRQKALSDLNEYKTFKLQI
    GEATSIQKKGSGYLIKGNGLSEIQTDKIIFATGVKDILPEIPGFAQAWGKTVIH
    CPYCHGYEYVGNQTGLWMNEEGVYEH
    AKFLKHWSKEITIFTNGPVQFSTEEINKIESEGISIQTEPVMEIVQKDGKISGLLFQLGKNIPLQTLYSKIPIVQHSKLP
    EELGCKLQPSGHIDVSPFYETSVQGVYAIGDMASMFRTVAHAVYSGNIAGAMLNRSMILS

    >gi|189912055|ref|YP_001963610.1| rhodanese-like sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MVREWSVYHTPYGIHFFLTPILARKKWKKEINMKTFVIVGVIIGFLFVFVKKIQSKGDKQMVQEWIQSGAVVVDVRTKSE
    FAEGHFPGSINIPVDVLPNELGAIKNKQSKIVVY
    CRSGARSERAKQILTASGYSSVINAGGLGDMPNSR

    >gi|189912059|ref|YP_001963614.1| protein-methionine-S-oxide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MIGLDCLFGKKLVPLAIFGLAFVLFPFCGPVTQISKQESLPLVPKSGQKIAVFAEGCFWCSEHIFESIPGVIDVVSGYAG
    GHTENPTYESVNTEMTGHAESVYIVYDPTKISYAELCRIFFLSHDPTTKDRQGPDIGSSYRSILFYADEEEFKIANTIKK
    EIQTQNIWNGTIVTEFQKLKHFYKAEGYHQDFIKNNPSQSYVLAVSIPRFKEFQNRYNEFKTRKTVP

    >gi|189912159|ref|YP_001963714.1| cation transport ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    METSNKLAEHTLDLFGMTCANCALRIEKGLSKVAGVSDVRVNFARESVFLRSEESVTVDSLLKTVEFLGYSATEHDPNKQ
    SETEKKQKDHIRVLKIRFILSALFSLPLFYGMVTHFQFLSFLPMPHILMDRWVQLVLATPVQFIIGFPFYQSAYRALRNG
    SANMDVLVVIGTSAAYGYSIFGKDLYFETSSVLITFILGGKWIEHVAKGKSSDGIKALLTLRPETATVKTNGVWTEVPNE
    YLKQGDLVLVKALERFPMDGIVTEGESYADESMLTGESMPVEKKQGDKILGGTVNGNGSLVVKAMKVGNDTTLSHIIRSV
    EESLGTKAPLQRIADQISAYFVPVVIAISILDFLVWFFLLAPGEITTAIETSIAILVIACPCALGLATPISLLVGTGRAA
    KRGVLFRSAEALESVSKINLIFFDKTGTLTEGKPKVTDVLVTGISDEKKSIVFGHVLAMEETSDHPLAKAILAFGKEKDF
    YLGSVGMVKTITSPGGGIQTELDGTVYFAGKQSFVEMNGFTIPETIRSAVEGWIKDGVSLVFVGIRGNMEGMIVFRIEDQ
    IRESSVKAIQELRSIGVEPILLTGDNLEAANKVAKAVGIVSVYSGLLPEEKSKIIKQLKNNQIHSAMVGDGINDAPALAS
    ADVGIAMGGGSDIAISTADVVLVNGDIQRIVDLIRIGKDTVLNIRQNFGWALGYNLLGIPIAASGLLAPWVSGAAMAFSS
    ISVVFNALRMSRWK

    >gi|189912193|ref|YP_001963748.1| dinucleotide-utilizing enzyme [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKSEKEIFFQRQCLVPEIGQEGQKKWNDASVLIIGLGGLGCPSALQLALAGVSRIGLVDFDVVEVSNLHRQTLFTWKDIG
    RKKTEVVSEVLKEHIPWIQIETFSEFLNSNSNTQIFETWDIVLDCTDTIISKYAINDFCLEKKIPLVTASVFRTSAQFAI
    FSGDGKPCYRCLFPNLSEGDTFS
    CNEGGVLGIQTSLAGNYQASLVLQYLLNPHQFELNTVYFIEWNPISFYQSKVEQDLQ
    CPSCSEQRYLKKSEGNCLEIDQVGYLELKSKTSVILLDVREEEEVIHSPIPDAVWFPLSELEKGKSPPGISDQTIVCVCE
    TGVRSLKATSYLTNFQNKFSLIGGRRVLSRFKNE

    >gi|189912217|ref|YP_001963772.1| rhodanese-like sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKELVLALEKFAIFSSALDDQSNSKLKYKNSNIQLDELQKKMKKGGILLIDVRSKEEYKKGHIPEAVNIPYNEIESFKFP
    KNKELIVY
    CRGPMCLLSVNALNFLQSREMNVTRFGGGYSQWEMREV

    >gi|189912226|ref|YP_001963781.1| oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MIQIVQLIIMIFLYLSCGGSSFESNYLPESLPSEDSIKETLSSDVHLSQLNEKAHSLGKNLQEWKESEKSLVSDQEINTY
    WQREKVRLRNSIPDTDAIDRLRESIRMRIVWSRIFHKTNINIKQKPIYQSKSNLLTQLDVQYSPQFGNKKAKWVIVEWSD
    YL
    CGFCKKTFPHTKNLLLKYKTQIHYIHKDFPLDGESDQSLIPLVVSRCLWEKDPTQFSLHMQLLYAHANHLAKGEAISS
    NNWNYFTECISQTSNARYRNLVEADWEEAKKLGVSSVPTFWVNGRWILGALDAETWERVLEDTKP

    >gi|189912305|ref|YP_001963860.1| thiol peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MAQVTLKGNPVPLEGSIPKPGDKAPDFKVAKQDLSDITLKDLAGKVKILVAVPSLDTPVCAIETKKFNEKVAKENGITTL
    IISGDLPFAMKRFCTTEGINSDNLITGSQFKDFSFSKNYGTHISSGPLAGLSARAVFVVDKDDVVRYTELVPEIGSEPNY
    DTVLAEAKKLV

    >gi|189912320|ref|YP_001963875.1| dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSNSNHFQVIVIGGGPGGYVAAIRAAQLGLQTCVVERDKLGGVCLNWGCIPTKALLESAHVLEHLKEAAKFGISADNIKV
    DFDAVIKRSRSVADQMAKGVEFLMKKNKVTVVSGEAKFLNSKSIEVKSISGEVTSLTADYFILAVGAKNKALPFLPFDGK
    RVLSAREAMVEPKVIANLAIIGAGAIGVEFADFYASMGSKVSIIEFQDHLLPNEDKEISSILERSFKKRGIEQYLSYGVE
    TASVSDSGVLLTIQDRNSAKKEKLNFDKVIVGVGISPNTNAIGLDEIGVKLKNGFVEFTGNYRSTVDHIYAIGDCIPTPS
    LAHVASAEGIRAAEDISVRLGNPHLLQINRLNYSYIPGCTYCHPEVASVGLSEDKAKAMGHELKIGKFPFSASGRAQAQG
    DTTGMVKIVSDAKHGEILGAHIIGPGATELIAELTLGANMEITVRELANTIHAHPTLAEGIMESAAAVLGEAINI

    >gi|189912326|ref|YP_001963881.1| protein-methionine-S-oxide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MTEKAILGGGCFWCTEAVYLRIPGVLSVVSGYAGGSSPNPSYKEICTGTTGHAEVIQIEYNPEIISYAKILEIFWVSHDP
    TTLNKQGNDVGTQYRSVIFYLNEKQKELAVESKRKHAFLFPDPIVTEISPAPTFYPAEDYHQNYFTLNPQNPYCHYVIFP
    KLKKLGLKLN

    >gi|189912402|ref|YP_001963957.1| alkyl hydroperoxide reductase large subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MLDESTKQQVKQYFERIKNPVSITLYSGDHEKREELVSFLNDIESLSPMISIQHSSDVTDGLRFTIISNGNPTGIHFSGI
    PMGHEFTSFILAILQSGGNPIKLEEGILSAVSKLKGEFRFETFISLD
    CHNCPEVVQTLNSFALVNPNISHNMIDGAMYPE
    LVKEKNIQGVPAVYLNGERFLSGKAEASIIFDKLLELYTIPSESESSDGLANPSEIYDVTVIGGGPSGVTAAVYAARKGL
    RTLVIADRLGGQVKDTLGIENIISIPYTTGPELIHVLADQLEKNQIKKKENVRVQKIEQGQTKIIHLNTGEKILSKTVIL
    STGAKWRELNVPGEKEFVGKGVAY
    CPHCDGPFFKDKDVAVIGGGNSGVEAALDLSGIVKSVTLVEFGDKLNADKVLLDKV
    ASSPNIKTLVKAQTTEIQTGVDKVTGLTYKDRNTEQVSTIPLDGVFVQIGLVPNSSFVKDLVATNRFGEILVDEKCKTNV
    DGIFACGDVTNTPYKQIIIAMGEGAKAAISAFEYLLHAA

    >gi|189912403|ref|YP_001963958.1| peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSNINTQIPDFTTEAFHNGAFKKISKKDVLGKWSVFVFYPADFTFVCPTELGDVADHYEELQKMGVEVYSVSTDTHFVHK
    AWHEASDTIKKIKFPMLGDASGKITRGFGVMIEDDGQALRGTFVVNPEGVIKTAEIHDLGIGRSAEELVRKVQAAQYVAN
    NDGEVCPAKWKPGNTTLKPGLDLVGKI

    >gi|189912556|ref|YP_001964111.1| thioredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSDIYPKSFETLLQTHDKPILVDFWAPWCGPCKMVAPELEKLAKDWKGKVSIIKVNTDEKQEIAGKYGISGIPTFILFKN
    GKEVHRISGAMRSEEFKIVFGSYL

    >gi|189912588|ref|YP_001964143.1| redox protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MTAVFEDKVIVTTEKSKYETKIRKGKHQWIADEPADKEGTDLGPMPTELLASSLGACTSITIRMYADRKGYALDSVTVQV
    TIDKRSPEDHKFIREVELKGNLKPEERERLHSVANA
    CPVHKILSGKIEIETVLIN

    >gi|189912675|ref|YP_001964230.1| protein-disulfide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MFSEIQTFIESQLSSGHFSIATVFFLALGGLLSGLLPCVYPLYPITAGILKTRVAKHKWAHPLVYYFGLALMYAIFGLIA
    GVSGGVFNSFLRYPETQLVLSILLFVLGLSVAEYLYFPFFSGDLKNSVNVNYANTFFLGMGAGLLSSPCVGPVVVSILVQ
    LVTYQTEGFKIVPILFTSFKMFVFGMGLGIPFLMIGVFGLSLPKSGKWMKYVQWVLAILIFYFSYTYLEKAFLLWGFDSG
    LSAKVYFLWTTSLVFLYLLNKEGTHSERMKHSLFQIFAITGFLFLFLILTHSILKLGPGISMGNRMSESTIQKEEHGNLV
    WYRNKNDAFQLAQDKNLPIFIDFYADW
    CTNCKEFQKLTLSHQELNQTFQNVVLWKVYDTDPIFEEFVNDPNYPELKIGLP
    FFLILSPNGKMLYKSNDYLDTKGMIETIRKLQKNNE

    >gi|189912682|ref|YP_001964237.1| rhodanese-like sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNRMILIIIAIVAVLFIVYQLRNVSGMDQSQLKEKIDAGALVVDVRTVTEFNSGHFPNARNIPIDEVSKRVDEFGDKNQT
    IIVY
    CASGGRSGSAKSFLESIGYKQVINAGGLSNMPNP

    >gi|189912744|ref|YP_001964299.1| glutaredoxin family protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSRSKLKVYEYSGCSTCRNALKYLNSKKIQFEQIPIRETPPSVSELKKAKQYLGDIKKLLNTSGKDYREGNWKEKLAKLS
    EDQIYKSLSENGNLVKRPFVVGDGWYLVGFKEEEWGERF

    >gi|189912869|ref|YP_001964758.1| NADH dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSQNKKKVVIIGAGFGGLQVIKTLANDKNFEVLVIDKKNHHLFQPLLYQVATAVLSPADIAIPTRSITTKYKNVKILFGE
    VTDINFKNKEVKFQNYTESYDYLVMATGAKTSYFGNPQWQNKTLGLKNLKDALAIRRQILLSFEQAELIADYETSKSLMH
    YVIIGGGPTGVELAGSIAELSHNIIRKDFRNIDSGMTKVTLIEAGPKLLNAFSESSSQFTKKKLESRGVEVLTNSPVLDI
    TDSGVVLKDRTIESKTIIWAAGVEGSDLAKKTSINKDKANRILVDEY
    CRSIDHNDVFVIGDAANFSKGLNRPLPGVSPVA
    MQQGRYVAKLIQSIDKGKKTIPFQYFDKGNMATIGRTDAVAEFGALRLKGIIGWFGWLFVHLVYQVGFKNKMSTLISWVW
    SYLTFRAGSRLIQEEVNDLSVRS

    >gi|189912906|ref|YP_001964795.1| Cation transport ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNKTNSQSTTTECDHCGNPIQLIRIESKLGDEPKVFCCEGCETVYSIIHSLGGSYYYNLKGNTKLSPVAMEETDVDLENE
    LVYQKFVRPSSGHSEVSIQITNIH
    CSACVWINEKVLNEEEGILSAQINFASGRARIRFDESKIKISRILSLIRAIGYKPV
    LFSPTEGNLQKSKQLKTLLLRIGVAGFCFGNIMILSVALYSGYFTGIDLNLKRMFHYASWVFATPAYLYSGFPFMSGFLT
    SIRRRTLSMDFLLFLGISMAYFYSVYVTLTDRGEVYFDSVAMIYFFILVGKYFEEKARVFASDKLESILCKLPETSNRIT
    ETGDQTIPSSEIKLGDKIQVAPGKRIPVDAILVSKETYIDESFLTGESVPIRKQKGDSILAGSLTMDNPALIIASSDYHA
    STLSSLKLRLEEALHLKPKIQIVTERIASYFISIVFLLAFVCFGVWMFLTSGDLEQSLVTTISVLIVACPCALGISVPTA
    LVTNHILNAEKGVLLKNPSVVETLAKANTIFLDKTGTLTEGKFLVRLVTVSEDHLPFVYRIEKEINHPLAKSLVKYLSPF
    DSVKKRASEMELIQLQNVPGQGVKAEIQWHGKEYSILIGNQTLLKHQNIPLESIPETEGSLILVAINGKMEGSFLLADEV
    RPGALSFVSLLKEMIPKIAILSGDRFSAVKFIANSLGIQQFYSDLSPEEKASIIEDSQNKGNVVIMVGDGINDSLSLARA
    NVSISHSEAEDLSLEKSDVVLTSGNLNGLVHSLLSAKKTKEVISQNIIISFFYNSIMLPLAMFGLMLPVICAVFMACSSL
    TVLLNSLSIRVRIPKWKPSI

    >gi|189912979|ref|YP_001964868.1| Methylated-DNA--[protein]-cysteine S- methyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MDFQKKHYQLIQNSIEYMIQNFESQPNLETLSGLAGLSPSHFQKLFLTFVGVSPKQFLSSITIMHAKRILPNTSILDTSY
    QLGLSGTGRLHDLFIKLEAMTPGVYKAAGEGLTLYYEFFPTILGEMVVVSSGIGIQNLQFIDETKTKDQILDQIKREFPK
    AIWMEEKSGRHLPMQQFLQTFSLPKDPIQLSVLGTPFQIKVWQSLLSIPIGEVTTYGEIAKSIGKTNAQRAVGTAIGKNP
    IAVLVP
    CHRVIQSSGLFGGYRWDPKRKQMLIAWEKSKHPPKQIHFV

    >gi|189912987|ref|YP_001964876.1| Dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MSINRFDLIAIGGGPAAQKAAIQASKLGKKAAIIEKDPYLGGGCVHWGTIPSKSLQETSRFYRNLKLSNLHGLQSPQTAQ
    LTLQELMFRAGTVIEKEEDVTREQMIQNRVTTLTGWGKIIDKNQVEVTDSAGRKKVYETENILIATGSSPRRPTNENIPF
    EEGLVYDSDGLFAMKKMPRTLAVIGAGIIGSEYATIFAHIGVKVHLFDSQSRILGFLDEDISNEMTRIMQNAGIQIHVDS
    SITSYQKISEETGFQLTTNKGEVITVNQVLISRGRLGNVDNLGLEAVGILPNDRKQIQVNENYQTNIPNIYACGDVIGFP
    SLASVSMYQGAYVAKHMFGLPSVPVDAEEFPIGIYTLPEIATIGPTEEALKKRGVPYGVGLAKFDTITRAQISGDQVGLL
    KILFDKQTRRVLGVHIISDKATELIALGQCVVNLKAPIEYFTEHIFNYPTMIGAYKNAANDALLREK

    >gi|189912989|ref|YP_001964878.1| Peroxiredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MNHLGETSMALRLGDEAPNFQADTSEGKIDFHEYLGQSWGILFSHPKDYTPVCTTELGYVAKIKPEFEKRNVKVIALSVD
    PVDSHKGWISDINETQNTNVNYPIIADADKKVSNLYDMIHPNASETTTVRSVFVIGPDKKVKLTLTYPASTGRNFDELLR
    VIDSLQLTSQFSVATPANWKDGEDTIIVPSVSDDDAKKKFPKGFRTIKPYLRYTPQPNK

    >gi|189912990|ref|YP_001964879.1| Redox protein, regulator of disulfide bond formation [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MHIHLKRIESPFVLEATNESGNSIKIDASPEIGGKNSGPRPMELLIMGLAGCSSIDVLMILNKHRIEVKDYSVDVEADRE
    KVGDANLFKNIHMKFFIKGDFQETQVKRAIDLSLEKYCSVAKTLEKTAKITYEFVLVP

    >gi|189913045|ref|YP_001964934.1| hypothetical protein LBF_4199 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
    MKRNLPFLFLSVVVFSMLFGFVCSPTAKESQKKPENPELRKKLTDLQYRVTQEDDTEPAFQNEYWNNHEEGIYVDIVSKE
    PLFSSKDKFESGTGWPSFTKPLVKANVVEIEDQSYGMSRTEVRSKLGDSHLGHVFDDGPKPTGKRY
    CMNSASMEFIPKSK
    LKERGYESFLSEFGK