Anaplasma centrale Israel uid42155

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269958468|ref|YP_003328255.1| putative DsbD gamma family protein [Anaplasma centrale str. Israel]
    MGVDCRDRWPMEHTFLDVLALAFVGGLVLNLMPCVFPILSLKVLSILRQSSEHRWSTAADGIFYTAGVLVSMLLLSVTLI
    LLRSAGHFLGWGFQMQSPALVIGLLHVTFLLGMSFSGFLDLSIKVPFISTMAGSHNVGSFLAGVLSALIGTPCSAPFMVS
    AISFALLQPGLRSVAIFQVMGLGMAFPYLVMSCSPGLTRLLPKPGQWMEYLKQFLAFPMYATSAWLLHVLVSQKGTHVLL
    PTVLSVVAVSLGVWFLRVMSNVKMQASKALAVLLPLFVVGTAIYIGRFRGHDHAYGELTKVEFSEARLARLLKAGKTVFL
    SVGAEW
    CLTCKVNEKVLESPAVQDFLCTHGVVYMKADWTNMDSTIAEYLSEHGGGGVPFYELYVNGKSVGPMPQIFSEKT
    LLEILSKHLNANPSSKASPE

    >gi|269958475|ref|YP_003328262.1| glutaredoxin 3 [Anaplasma centrale str. Israel]
    MREVLIYTKVPCPYCTRAKALFNKKNVPFKEIDITDNPEAMREMVERSGRRTVPQIFIDGKSIGGCDDLYALYESGELEL


    >gi|269958677|ref|YP_003328464.1| dihydrolipoamide dehydrogenase [Anaplasma centrale str. Israel]
    MGACDYDVAVIGAGPGGYKCALKAAKLGLKVASIDNNSLLGGTCLRVGCIPSKALLDYSYKYHAVRDIFKDFGVTASNVK
    FDLRKMFEVRDREINALGSGIGSLFSSAGIERLCGAATVTRAMGDGFEIVVRRGGAPTDDKLSAKNVVLATGSLPASLRG
    IDIDEVRILSSDGALGMDVPGKLLVIGGGAIGLEMSSVWSRLGAEVTVVEYADCIAPGFDSEVSKALLSHLKKQGINFML
    SHKVVSVSEKKGGKLAVSCESLSGGAVSAVEVDKVLVAVGRRPNVDGAVAIDGLVLDDRGFVSVDGRYETSIKGIFAIGD
    VIGGAMLAHKAEVEGHAVAELIAGGTSSVDYGVIPAVIYTHPAVASVGRSEDYVKDIGYDYKVGKSSFAANGRARVTGES
    EGFVKVVSCKRTDTILGVHIVGTYADTMINEAVVALGYRASSRDICHICHSHPDVNEVFRDACEIACFRKG

    >gi|269958728|ref|YP_003328515.1| putative Fe-S protein [Anaplasma centrale str. Israel]
    MSDLESCGLTLTEGAVDKIMAVLQEEGGSSLLKVSVQSGGCAGFKYEFTTGPYEDDADDEYPEEDDSGFDDMDGDEEDSD
    EVEGGSDLILSDASGRPILFVDRCSRKFLKDSTIDYVEDINGSRFVVNNPAAKSGCGCGNSFSL

    >gi|269958741|ref|YP_003328528.1| putative peroxiredoxin [Anaplasma centrale str. Israel]
    MDITEGGVAPEFVIKLEDGTAVPSSAYVGKKNIVLYFYPKDDTPGCTKEAEGFRDAHAEFAHLDTVIIGVSGDGVSSHAN
    FRKKYQLPFELIPDEDSSLSELYGTWVKKHMFGKSYMGIERSTFLIDKHGKIRKIWRNVKVDGHVNAVLDAVKSL

    >gi|269958759|ref|YP_003328546.1| putative Fe-S cluster assembly scaffold protein [Anaplasma centrale str. Israel]
    MPKGINVEVLMELSIEQGNWGDGLSPIVVTDAAWRRMKELLTDKGDPDVAIRILVKQKGCYGFKYHIEYAYGARPLEVKV
    EKVFDGFKVVVLIEPKAMMFIRGTTVDYYSDRLSSGFVFKNPNEKGRCGCGDSFYV

    >gi|269958794|ref|YP_003328582.1| thioredoxin reductase [Anaplasma centrale str. Israel]
    MVGVKIHATSDVAIIGAGPVGLFTVFQAGMLGMSACVIDALDEVGGQCAVLYPDKPIYDIPAYPVTLARDLVNNLKQQAD
    PFKPTYLLGHTAEQVLEEGEHFVVVTDKKVGVRCRAIVIAAGSGGFGPNRPPLDGITEYENKSVFYHVSDVSRFRGKRVV
    IAGGGDSAADWAVSLSEVADSVHVVHRRQSFRCAPNTLRNLENLAEHDQIKLWVPYQLAGLAGSDGMLNGVIVRNISSKE
    ETRIDADFLLPFFGISAKLGPIANWGLGVESFYIPIDQSTCRTARARIYAVGDVAHYQGKLKLILVGFSESALACHDIYK
    VLFPDTPLNFQYSTSKKMPC

    >gi|269958862|ref|YP_003328651.1| peroxiredoxin (PRX) family protein [Anaplasma centrale str. Israel]
    MNLVTKEAIDFTARAVMSDGKVCDLNLSKHVAGKCAVLFFYPRDFTFVCPTEILSLHSRVPKFTARNAEVIGISTDSEFA
    HSHWRSTSVERGGIDMISFPLVADDSHTISESYGVLHSGKVALRATVIIDEDFIVRHHSVNDLPIGRNIDEVLRIIDAIA
    HHRKHGEVCPAGWAQGKAAMEATQHGVEHYLQSHADSLGPQE

    >gi|269958863|ref|YP_003328652.1| thioredoxin reductase [Anaplasma centrale str. Israel]
    MTEQQQAKTPVKVLVMGSGAAGCTAAIYAGRANLGPLLVTGMQPGGQLTITTDVENYPGFSLVQGPELMEHMKQQALHCG
    ATEVMDEITQIDANVYPFRCTSMFGEEYYAYSIVVATGAQAKWLGIDSEQFFMGKGVSA
    CATCDGSFFKGEVVTVVGGGN
    TAVEEAIYLTRSASKVFLVHRRDKLRAEAVMQSRLFENSKIEVVWNSVVKEVLGDKENKKVGALLLESTLDGSTRILETA
    GVFIAIGHKPNTQVLADMPGRHVALDPDGYVITSPDSTATSCPGIFAAGDVRDKVYRQAVVAAGTGCMAALDAEKFLSER
    GIAS

    >gi|269958953|ref|YP_003328742.1| glutathione S-transferase [Anaplasma centrale str. Israel]
    MADTLYYFPPCPFSRKVRILMREKGLDFSMVEENPWKRRKEFVEINPVCQVPVLVSTKSVVVDSQAICEYIEEVYGGESR
    MGRSPYERAKVRRLVYWIDCKFYHEVTRYVINEKIAKQYTKHGSPNPSLIRASMSNLQSHVRYMEHLIDTNGWLASREFT
    LADIALSAHISLLDYMGIFPWDLSPTLKEWYSLVKSKPSFSQILGDRIPGFAPPVHYAQLDF

    >gi|269959075|ref|YP_003328864.1| dihydrolipoamide dehydrogenase [Anaplasma centrale str. Israel]
    MESCDVVVVGSGPGGYIAAIRAAQLGYSVTVIEKEESLGGVCLNWGCIPTKSLLKSAEIYSTLLKADSFGVTVSGNVSVD
    ISKVVARSREAVSKLGHGVAGLMKKHGIRVLMGFAQVLGGGKVAIAQEGEPLTLTAKHIILATGASARPVPGLDEKMLWM
    ARDAMLPKCLPKSLLIIGSGAIGIEFASFYSHMGSKVTIVEMQDRILPLEDKTVSESMQKILQAQGIEILTGGSVCSLKK
    AGAAMQAQVKLGTQKVVTLECEKAIAAIGVIPNTHGLGLENTKATLDERGFIVTDDCCRTAEPDLYAIGDVAGPPCLAHK
    ASHEAVICVEGMAASDGILKDKPHPLGVHNIPSCIYSIPQVASIGLTEEQARAQGLDIRVGISRANCSGKAIVSGAVDGF
    VKVIIDSTSGELLGAHMVGEEVTEMINGYVVGKNLEATDLDLLSTVFPHPTLSEMMHEAVLAALGKPLNG

    >gi|269959112|ref|YP_003328901.1| putative reductase [Anaplasma centrale str. Israel]
    MRVVAITTLALFCLLSLTLSGVYYNRNFKKPSYHITLPAIVGTEKEFRTENIEGAYVIHVFASWCATCLEEHKIWMSIAN
    EKPIRVYGVAYLDVQHKTLEWLAKHGNPYAMVAADYSGRVMKKLGVTGVPETLVFSRTGEMVMHVSGAMTEDLWKRIFTL
    VS

    >gi|269959114|ref|YP_003328903.1| glutaredoxin-like protein GRLA [Anaplasma centrale str. Israel]
    MSSDPVADRIRNEIETSDVVLYMKGTADAPQCGFSGVVVEALRNVGAKFRDVDVLKDPELREGIKKFADWPTIPQLYVKG
    EFIGGCDIVREMYHSGELHALLKSKGIIAG

    >gi|269959125|ref|YP_003328914.1| putative disulfide oxidoreductase DsbA [Anaplasma centrale str. Israel]
    MARIFCLLSLVVLVASFPLISKFVSGVKGQDREEIEAIIEEYIYKNPNKVISALSKGQAAMNEAEMRKRVAENRVALDDV
    SYPSFGNRESKVLLVEFFDFS
    CGYCKSMLSHIKQLLDDGKARIVFRDLPALGEASTLAARAALAVHFINPEKYVDFYYAA
    LDHNKRFTDDGVVEIAESIGIKEEDLKKSLEQNDSKINAMINATRDLAERLNIGGTPSVVVGDTVLVGVSDLQALRDLIQ
    GATQNGKGSSR

    >gi|269959141|ref|YP_003328930.1| putative isomerase [Anaplasma centrale str. Israel]
    MVGIMRFLRCYLGVSFAICLCSVLVGFSAAADAKVDAPSNSEVDAVNTADITAEKLLGLIPGDRFLGNTSAPVVMVEYAS
    FS
    CSHCADFATKVLPRLKSEYIDKGKLLYILRDFPLDKLSLSAAMLGTCYKDNKTFFAYAKAVFNSFDALIATHKDLGLL
    SNIAKISNISDEEFKKCTTNEALMDRVVQQKFLAVNKLDVNATPAFFLNGQRYEGSHDFTSVSAEIEKLILLNPNYSALD
    GKATKLERAKK

    >gi|269959153|ref|YP_003328942.1| thioredoxin [Anaplasma centrale str. Israel]
    MSNIAEVGDSDFPEKVCVGSGLVLVDFWAPWCGPCVALSPQLEKLAQKYEGKLKIYKLNIQNNQDTPVSYGVSAVPTLVI
    FSDGKELSRVVGANLQQIIGAIDSAIGAGQ

    >gi|269959165|ref|YP_003328954.1| putative molybdopterin and thiamine biosynthesis protein [Anaplasma centrale str. Israel]
    MCASRSDFQYRYARQVLVPEIGHHGHNKLRQSSILVTGCGGLGSVVIPLLAASGVGKLVVCDDDTVRISNLNRQTIYREQ
    DVGCRKVRAAAEFIKNLNRDVEVHEIDCAIGPKNFEAILSDVEIVVDCVDRLTVKMFLNDACVAMHKTLVHCAAIGFTGE
    VMVIPPGGRPCYRCFFEGQQVSTKLN
    CANAGVASPTVGVVGSMAAAEVIKYVVGHYQSSVGKLYRVDLRSNNFTPYECAV
    NSLCSCCSDAASVDPHDFESYEGKLR

    >gi|269959171|ref|YP_003328960.1| putative peroxiredoxin [Anaplasma centrale str. Israel]
    MAAVVTPTLDAGFTARDFRLKATDGGYYGLDNFRGSSALLVMFICNHCPYVKALIKHLVREVKLLMADCGVGAVAIMPND
    TDAYPEDSYDKMAALAQSLAFPFPYVIDEGQSVAKSYGAVCTPDFFCFNRELQLCYRGRFDDPNKDWGLCPDDRSELFEA
    VRFVAETGKVPGDQVPSIGCSIKWRSG

    >gi|269958258|ref|YP_003328045.1| hypothetical protein ACIS_00004 [Anaplasma centrale str. Israel]
    MKSIIVAGEGLVRGALMVPRVLYNKCFIAVFCVLAVASFILIGSMNNYELELERSSIKIQEINSDEALYGLVSKIGAGPT
    LLVLYTSW
    CSNCVEKMPEVISIIGAYKDVEPVVISLDTNREKLAGFLLSQKQVNFVPYNVSPAYHSKLAYALAGKGVYFD
    GRIPYIAVLSEGSPPAGNITSSRALRAVMDSITSAKTQQ