Leifsonia xyli CTCB07 uid57759

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50954028|ref|YP_061316.1| thiol:disulfide interchange protein [Leifsonia xyli subsp. xyli str. CTCB07]
    MSPRPRLRRALPAVAVVAALLLAGCSSNDSLAAQYRSGSGQGYIAGDGSVSEYPSGKRGEPVRFQGKLADGAAVFSKDYA
    GRVLVVNFWYAG
    CPPCRLEATDLEALSQKHASDGVEFLGVNLYDTASTAASFEKDKGVTYPSVLDRDTGSVLLAFSKTVP
    PKATPTTLVIDKKGRVAARILGGLPDRSILDALISDAVAEN

    >gi|50954364|ref|YP_061652.1| hypothetical protein Lxx05860 [Leifsonia xyli subsp. xyli str. CTCB07]
    MREEAAKKAKRRKVAVQSSVIVGIVAVLAIAGIAIYSGVSASNSVANPKNLLSGGLLLSAPGKAVTTPAIKQGDAATPAK
    QELDGKTAHIQVWVDYQ
    CPICEQFEAANGATIKQMLTDGTATLETHPVAILDNAPNKQYSTRSAVAVACVADEQPNKFLD
    VNAALFANQPSEQTGTGLTNAQILKLFKDAGVESKTITDCTNSQTFATFVTNQTKAAAADPQLRNSSGSFGTPTVFVNGQ
    RYQGSVTNAEQFKAFIAAILPEKTSGSVTFPTAAP

    >gi|50954417|ref|YP_061705.1| methionine sulfoxide reductase B [Leifsonia xyli subsp. xyli str. CTCB07]
    MTQEYRKDRDAIGRLTAAQFAVTQESATEPAFRNEFWNSHEAGLYVDIVSGEPLFASVDKYDSRSGWPSFTVPVEPGNIV
    EKTDRSFGTLRTEVRSAHGDSHLGHLFDDGPAEAGGLRY
    CVNSAALRFVPLAELDEQGYGDYKRLFENEGEGGRR

    >gi|50954418|ref|YP_061706.1| methionine sulfoxide reductase A [Leifsonia xyli subsp. xyli str. CTCB07]
    MTERAILAGGCFWGMQDLIRKRPGVLRTRVGYTGGDVPNATYRNHGSHAEAIEIEFDPSRIGYRDLLEFFFQIHDPSTAN
    RQGNDVGASYRSAIFYEDEEQRRVAEETIAEVDASGLWSGKVVTEVSPAGPFWEAGPEHQDYLERIPWGYTCHFPRPGWT
    LPKREAAGD

    >gi|50954459|ref|YP_061747.1| methylated-DNA-protein-cysteine S-methyltransferase [Leifsonia xyli subsp. xyli str. CTCB07]
    MSSSSRYLLSVPSPIGRIELTGDGEAVTSLSIARGGILPHGERPEYTSAVLDDAAEQLAQYFAGDRRDFDLPLRLEGTPF
    RRAVWERLAGLGFGTLTTYGELGLALGHSGYGRAVGGAVGANPVPIIVG
    CHRVLSSSGKVTGYSGGEGIPTKLWLLEHEG
    MTLAT

    >gi|50954482|ref|YP_061770.1| cation-transporting P-type ATPase [Leifsonia xyli subsp. xyli str. CTCB07]
    MTEPALTRIDLAIEGMTCASCVARVERRLGRLDGVEAVVSLATERASVLAPAGVEAEALVAEVKRAGYGARVLTGSRDIT
    REQRPDAQRLRLRLLAAAALSVPIALLAMVPAFRFPGWELVSLVLAAPVVLWAGWPFHRSAAVNLRHGATTMDTLVSLGT
    LVAFAWSVAVLALGAGGHIYVEVAAVVTTFLLLGRFAEERSRRRAGAALRDLIAAGAREVSRVDDAGRERRIPVDLLGAG
    ERFAVRPGERIAADGIVLEGAAAIDASAVTGESVPVEVAVGDEVTAGTIAAGGSFIVRATRVGPDTRVARLVAGVEAAQL
    AKTRAQRLADRVSSVFVPVVLGLAVLTFLTWVVVAGDPAVALSPAVAVLIVACPCALGLATPTALLVGTARAAQRGIQLS
    GPDALERAGRIDTVVFDKTGTLTTGRMTLLETVAGTGWAADEALRLAAAAERGSEHPLGRAIAAEVPAVGPVTGFRALPG
    VGVTACVAGREVSVGKPGEPLPADLAAAASRIRSAGGTAIAVSVDGVPAAVLGVGDPLRPYAAEAVARVRVAGAEPIVLS
    GDHPATVAAVTARLGIARTLGGVSPEGKADAVASLRAEGRRVAMVGDGVNDAAALAGSDLGIALGSGTDAAMAAADITLL
    RPEPVIVGDVLSLSRRMAAVIRGNLFWAFAYNVAALLVAAFGLLAPMVAAAAMGFSSVFVVLNSLRLRRF

    >gi|50954485|ref|YP_061773.1| glutaredoxin [Leifsonia xyli subsp. xyli str. CTCB07]
    MTDRFDKVTVFGADWCRDCIRSKALLDRVGADYEYIDLVARPEEADRAQAISGRTSIPVIVFPDGRHLVEPTDPELLAAL
    KG

    >gi|50954699|ref|YP_061987.1| dihydrolipoamide dehydrogenase [Leifsonia xyli subsp. xyli str. CTCB07]
    MSEQNFDIVVLGGGSGGYAAALRAVELGFTVGMIEKDKVGGTCLHRGCVPTKALLHAAEVADYSRESGKYGIVTQMQGVD
    INGVTEYRQGIVTKKYKGLQGLVKARGITVIEGEGRLVSPTTVQVGEDTIVGKNIILATGSFSRSLPGLEIGGRVITSEQ
    ALELDFVPQKVAVLGGGVIGVEFASVWKSFGADVTVIEALPHLVPNEDESISKSLERAFRRRGIDYRLGVRFAGVSQHEN
    GVVVSLEDGSTVEEELLLVAVGRGPLTQGLGFEEAGITLDRGFVITDERLRTSVPGVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGLNPVVIPDVNIPKVTYCDPEVASIGLTEIKAVEQYGADRVTSYDYSLAGNAKSEIIGTNGSVKVVRVNDGPVVG
    VHMIGARVGELIGEAQLAVNWEAYPEDIAPLIHAHPTQNESLGEAFLYLSGKPLHTL

    >gi|50954733|ref|YP_062021.1| thiosulfate sulfurtransferase [Leifsonia xyli subsp. xyli str. CTCB07]
    MSIGADPSPAFAGYAHPKRLVSTEWLAAQLGAPGLVVVESDEDVLLYETGHIPGAMKLDWHTDLNDPVIRDYVSPERFAE
    LLGSKGIARDTTVVVYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDKWIAEGRELTREATAPQPAEYPVVKRDDTRVRT
    FKDDVLAHRGKPLIDVRSPEEYSGERTEIPGYPAEGALRAGHIPSAASVPWGRAAAPDATFKRRPELEALYLGEAGLTPG
    DEVIVY
    CRIGERSSHTWFVLTHLLGFESVRNYDGSWTEWGSAVRVPIVMGSEPGGGR

    >gi|50954752|ref|YP_062040.1| thiosulfate sulfurtransferase [Leifsonia xyli subsp. xyli str. CTCB07]
    MTATRARELIEAGAAWLLDVREQREWEAGHAPGAHHIALSEFDGRQHELPEGEQILVICRSGGRSRMVTDALLRASRLAA
    NVSGGMDAWASSGGAVTRPDGSPGTVV

    >gi|50954926|ref|YP_062214.1| AhpC/TSA family protein [Leifsonia xyli subsp. xyli str. CTCB07]
    MALENDTQAPDFELPNQHGQAVRLSDFRGRKAVTIVFFPLAFSGTCTGELCELRDNLALFEDHRVELLAVSVDSKFTLRA
    WEEHEGYGFSLLADFWPHGGIAKEYGVFLPEKGFANRATFVIDESGIIRASFITAPGRARSIDTYRTALDLLPAHVG

    >gi|50954961|ref|YP_062249.1| pyridine nucleotide-disulfide oxidoreductase [Leifsonia xyli subsp. xyli str. CTCB07]
    MTTAGFEVIVVGGGPAGLSAALNLARARRRVLVVDGNRPRHAATLQAHGFLTRDGVPPSELRRLGREEVDSYANAVIAFA
    QVDAIEVEGGGYRVRGRGVSGAPDVDAWAEDVVLATGLVETLPGIVNLRAFYGTQLHS
    CVECDAFEKAGEPLALIGETPD
    LAERALLLSQWTDDLLVLTNGVARIGEVEERALARLGIAIERCPIAEVTGERGVMTGLRLADGSFIDRAAGFVRSVWTPS
    LAFLDGLELDRGPDGCLLTDAQGRTSLPGIYAAGETTAPGPQQLVIAAGSGAVVAAAVNRDLIGIAVGDARML

    >gi|50955050|ref|YP_062338.1| thioredoxin [Leifsonia xyli subsp. xyli str. CTCB07]
    MDATPAVDPSVTAGVALTLYTSAFCEPCTRTRAVIAEAARIAPRLSVTERDVARSIELAEADGIRSTPTVIVNAADGTEV
    FHAEGVPTLQQVLAAARAV

    >gi|50955131|ref|YP_062419.1| hypothetical protein Lxx15060 [Leifsonia xyli subsp. xyli str. CTCB07]
    MTDTALTGTQAHGVGLTDTAAVKVKSLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERMLDGDAAVDFDGVEVIVDKMS
    VPYLDGATIDFEDTIQKQGFTIDNPNAAGSCACGDSFH

    >gi|50955220|ref|YP_062508.1| ATP/GTP binding protein [Leifsonia xyli subsp. xyli str. CTCB07]
    MPVTNASTTVWSGDLMKGSGTVTLDSSNATSLSIHWKARSQGGAEVTTPEELLGAAHAACFSMAFSHALAGFGASPESVK
    TTAAVTFDPTEGITGSHLTVVATVPGISEEDFHSIAEEAKSS
    CPVSRALVGIPITLDASLA

    >gi|50955330|ref|YP_062618.1| glutathione peroxidase [Leifsonia xyli subsp. xyli str. CTCB07]
    MSLMDIPFRTIDGEPTSLAAFAGKVILVVNVASRCGLAPQYEKLEGLQKTYGDRGFTVIGFPSNQFLQELNSTDAIKEYC
    STTWGVTFPMMEKVKLNGRSAHPLYAELTTYPDAAGKAGKVKWNFEKFMITPGGAVHRFRPTTEPDAPEIIGLIEQALPT
    AV

    >gi|50955365|ref|YP_062653.1| oxidoreductase [Leifsonia xyli subsp. xyli str. CTCB07]
    MDAGKGEYQIAKSDEEWRRELTPEQYGVLRQAGTEQPWTGELLDESRAGVYACAACGAELFRSGTKFDSGCGWPSFYESV
    RPEAVELLEDTRLGITRTEVRCANCGSHLGHVFPDGFRTPTGDRY
    CMNSISLDFQPEDE

    >gi|50955460|ref|YP_062748.1| bacterioferritin comigratory-like protein [Leifsonia xyli subsp. xyli str. CTCB07]
    MTDARLEAGQAAPAFTLKDQDGKSVSLADYAGEQVIVYFYPAAMTPGCTKEACDFRDSLASLASSGYRVIGISKDAPAKN
    KRFAEQEGLNFPLLSDEDLAVHSAYGAYGEKKLYGKVVEGVIRSTFVLDTDGSVRLPLYNVKATGHVTSLRKKLGLD

    >gi|50955946|ref|YP_063234.1| thioredoxin-disulfide reductase [Leifsonia xyli subsp. xyli str. CTCB07]
    MRQIIIIGSGPAGYTAAIYAARANLKPLLIASSVEAGGELMKTTEVENFPGFPDGVMGPDLMVKMQAQAERFGTEVILED
    VVSVDLSGDAKTVTLGSGAVHEALSVIFATGSAYRKLGLEDEERLSGHGVSW
    CATCDGFFFRERTIAVVGGGDSALEEAT
    FLTRFADKVYVIHRRDSLRASKIMQDRAFANNKIEFIWNSEVVAINGSEQVEGITLRNRENDDQSDLDVQGLFIAIGNDP
    RVHLVHGQLDLTPEGTIAVAGRSSKTKLTGVFAAGDVVDSSYRQAVTAAASGTVAALDAEHYLSDLPQDLLDNATDIAPG
    DLELTTTA

    >gi|50955947|ref|YP_063235.1| thioredoxin [Leifsonia xyli subsp. xyli str. CTCB07]
    MSATRSVTDVSFEQDVLNSEKTVLVDFWAEWCGPCRAVGPILDQIAAEHSEKIEIVKLNVDENPQTAAKYQITSIPAMKV
    YQGGEVVKTVIGAKPKPALEADLAAYLA