Leadbetterella byssophila DSM 17132 uid60161

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312128912|ref|YP_003996252.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MYKHLLLLLLGTGACAQKLSAEELSKKLEAEPQVQLVDVRTPSEFKAGHIPNASNIDVRSPQFNSMVATLDKSKPVYIYC
    LSGGRSSSAANKLREMGFQEVIEMPGGMMEWRNKSLPEEKLIVKSEGLSLEEYRHMIPTNLPVLIDFYADW
    CAPCKKMKP
    YIEAIEKEGKVKVIRIDADQNPRLMKELNIVGLPVIKLQKGDKTWEHVGFVSEMDLRAQIAEITK

    >gi|312128914|ref|YP_003996254.1| hypothetical protein Lbys_0105 [Leadbetterella byssophila DSM 17132]
    MKILTQPWPWYVAGPLIGLTVPALLLIGNKAFGISSSLRHLCAACLPTKLPFFQYDWKKESWNLFFVLGIAIGGFIGGVI
    FGNPEPVQVAESLKADLSNYGITDYSQLVPADLFNWPALVTPRGFILMIVGGFLVGFGTRYAGG
    CTSGHSIMGLSNLQWP
    SLVATICFMAGGLIMANLILPYILGL

    >gi|312128922|ref|YP_003996262.1| DNA-o6-methylguanine--proteiN-cysteine s-methyltransferase; transcriptional regulator ada [Leadbetterella byssophila DSM 17132]
    MNDQQQLNYNRIAQAIEYITEHFKEQPQLDEVAEMVHLSPFHFQRLFKEWAGTTPKKFLQYTSLQYAKRLLQDQQATLFD
    TAYQTGLSGTGRLHDLFIQMEGMTPAEFKNGGRNLSIQYSFADSPFGKVIVASTSKGICHMAFEEDEDQALWNLQQKFPF
    AKYQNLFDDLQANALSIFQTDWTQLKQIKLHLKGTEFQLKVWEALLKIPFAGVSTYGKIADKIGQPTASRAVGTAIGSNP
    VAFLIP
    CHRVIQSTGHLGGYMWGKTRKTAMLGWEAAKSD

    >gi|312129043|ref|YP_003996383.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MKVEQIYTGCLAQGAYYICSEGEAAIIDPLREVGPYLQRAEKDQSTIKYVFETHFHADFVSGHLDLSKKTGAPIVYGPTA
    KPNFPAKIAEDGEIFTIGKIKIQAIHTPGHTLESTCYLLIDEEDKPKALFTGDTLFIGDVGRPDLAQKVVEDLTQDKLAG
    MLYDSLRNKIMPLPDDIIIYPAHGAGSACGKNMSKETSDTLGHQKQTNYALRDITKEQFIKEVTDGLLPPPIYFPENVKM
    NISGYESLDTVMERGLQALDAEGFETAANATGALILDTRSPQEFAKGFIPNSINIGIDGSFAPWVGALIPDIRQEILLVT
    EPGREQEVITRLARVGYDKTIGYLKGGIESWKGKEMDHITSISPQDFVDNHFPVENILDVRKPTEFQTGHLETAKNVPLD
    FINENLSELDKDQTYYIH
    CAGGYRSMIFASILKSRGFENVVDIQGGYKALVETGTPTTV

    >gi|312129369|ref|YP_003996709.1| redoxin domain protein [Leadbetterella byssophila DSM 17132]
    MRKFWVLFLLAFAVQGQSPLDTSKVYTEKLPWDSPRFFDNNYQYSRFQSHGIDALEMEWFEEKAKLKKSLPDKSNWAEEL
    EFQYWHLIFAYPVERGNADRKLRRLQSLPTDITKPFQVALLQDEKYLQSRAFRNLLPYYITYENSKARGFEKYSNGLEMA
    NDKVEYIEKHFKGKIRDYALARILLDQQKYIQAAVAKRWVERIEDKEIKAQFGEKYFAQFTTLKQEVTLPELSFVDMAGN
    AKSLADFKGKVVYIDFWASW
    CGPCKVQFPFAKKLHEQLKGKDIVFLYLSLDDTAERWKEGIEDNGLGSFANGYLEQGWKT
    PFLVQRGVNGIPRYMILDKEGKLVDENAKRPNDADLLPVLLKYIGEGK

    >gi|312129387|ref|YP_003996727.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MTRIILLLFLLPYVNFAQHAYKLLEPYDFEQVLRTNKDGVLIDFRDVDSYINGHIRKSIVVDFLRDDFKEYFTAKYPKDS
    KIYLYAQAGESTLECAQYLHELGYQNLTVLNGGFEKWIKASRPYVSVSPSFKPLGFITPEEYSQMVRQSKWTLVVFQELH
    CPPCENLHYAELKALYPELAIQKIIISEQKNLAEKLNINKNPTLVLYKEGVQVWRESQDIKTSKIKENIY

    >gi|312129567|ref|YP_003996907.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Leadbetterella byssophila DSM 17132]
    MTRRELIQQYGFALTALAMPFPLITFSKDNSMTDKKQFDVIIIGGSYAGLSAAMALGRSLKNVLIIDSGKPCNRYTPHSH
    NFITQDGSVPGEIATKAKEQVLKYDTVKFFEGYAAEGKKTENGFEIAVQSGERFSAKKLIFATGVKDIFPDIKGFEECWG
    KTVIH
    CPYCHGYEFKGAKTAVIAKGDRAFHVASLVNNLTDKITIVTRGKADFTEEQSVKLKNHQINIIEKEIEEIKHQNG
    NITALIFEDGTQETFDAAYAALPFEQHCKIPLDLGCEITETGLIKVDMFQQTTVPGVYACGDNINPLRSVANAVSSGNIT
    GAMVNHRLTEEKF

    >gi|312129576|ref|YP_003996916.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MPYSRIILSTSLPLSNSLRILAIWVGLNLLVFIITVLKLRKNSTFKPYYFRGSLQNDTLQLLRNQLANLIKKTREIKDPD
    YFTEEEKRDSALVNHNKKELENIFYNIVDTELAFAEQYPNSYVSLDILANRSRINTYIEKVASIYDHLAENLKQTPQGDI
    ISERIKKKRQVVVGMKAIDFSMKDTYDNIVNLSYFNGKYVLLDFWASW
    CGPCREEHPNLISIYENYKNKDFTILSVSIDT
    DKEKWIKAIDKDKLTWTQVSDLSGSKGEVYLKYGITSIPANFLIDPNGLVIAKDLKGDGLKSELSKIFKTE

    >gi|312129578|ref|YP_003996918.1| alkylhydroperoxidase like protein, ahpd family [Leadbetterella byssophila DSM 17132]
    MQKRFNFKEVAPSALKAMVGLEMYLSKASISKTSKELIKIRASQINGCAYCINIHTQDAIKSGETNQRIFLLNAWREAED
    IFTEEEKVVLAITEEITLIHQNGLSDDTYSTALQFFSETQIADIITAIITINLWNRVVLSTHLPIGQSLA

    >gi|312129602|ref|YP_003996942.1| methionine-r-sulfoxide reductase [Leadbetterella byssophila DSM 17132]
    MYKYVLLALMISCTSQKEMSMNKTEQEWKELLTPMQYYVMREKGTERPFTGEYWDHKEKGVYKCAGCGEQLFTSDQKFDS
    GCGWPSFYDALDKSKIKVEKDFSHGMIREEIMCKKCGAHLGHVFDDGPAPTGLRY
    CVNSASLGFEKKK

    >gi|312129631|ref|YP_003996971.1| osmc family protein [Leadbetterella byssophila DSM 17132]
    MKITLDRVDDAFHLEGKGMSPVVVHLDAAEEIGGKNAGSRPMELLLMGLGGCTSIDVILVLKKQRQELRDLKIEVTGERE
    QIEGTEMKPFRKIKIHYKFYGPLDPAKVERAIELSMDKYCSATAQLRPSAEITHSYEILP

    >gi|312129636|ref|YP_003996976.1| hypothetical protein Lbys_0877 [Leadbetterella byssophila DSM 17132]
    MNRLKDESSPYLLQHKDNPVHWWPWSQEALDSAHKEDKIILLSIGYSACHWCHVMEKECFEDHEVAELMNKHFVNIKVDR
    EERPDLDHLYMDALHMMGLQGGWPLNVFLLPTGEPIYGGTYFPKKKWMGVLRSLLQVFTERRDEVEASGEGFRNSLQNNE
    LIKFAKTSSEIYYTKEEASQMAENLSAHFDVSEGGMDRAPKFPMPSLWQMVAHLAQFTENDALREHYDFTLGRMTLGGIF
    DHVGGGWCRYSTDAYWMVPHFEKMLYDNAQLLALHQQYPTPISDWACRKTVQWLDREMKVASGGYYAALDADSEGEEGRY
    YVWTEEELKLASIPTEVLNEYGISERGNWEDGKNILHLEHWPKNWEEIKESHEKLLEIRENRVRPGLDNKLITSWNALLV
    NGLMGVEPDKAKDLMDYLLASHTFLCKNEDGEEALGCFHLGKNDKILGFLDDYASLILASIEVYSHTFDETYLEKARKMI
    NYVLANFYDPEDGFFFYTDSQAERLIAKKKEIYDNVIPSSNSMMAKALYFGGRYLAEREYVKIAEDMVAKIQPMTLKDAQ
    WLSNWVDLILYMSEPQIEWVITGPEAMWWAEVLKIKRKTSSTLILAGEKESQLPLFHDKFLAKTALFVCENQACQLPIFD
    LNEL

    >gi|312129685|ref|YP_003997025.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MKRKILALSLLSLSASAQVHIEGKLISSPAKKVYLQEFKDKIFYTIDSAVVKEGTFSFHKNITTPEVYGLTLDQEKSPVF
    LYLDEQDKNISVELDSSSYYKNTKFSGSSAQDIFEEYKSAGRDFDIKAFINKYPKSVVSAYVLYRNFAYRLEADQIREYL
    GILSPELQNSPYGKNLKAYLETLELVKIGQKAPDFTLADTEGKSVRLSDKFGKYLLVDFWAAW
    CGPCRKENPNVVAAYQK
    YHELGFDVFGVSLDRTKEAWIKAIEKDQLTWTHVSDLQYWKSAPAALYGVRAIPANFLLAPDGTIVAKNLKGKDLHDTLE
    QLLGSTKAP

    >gi|312129717|ref|YP_003997057.1| thioredoxin [Leadbetterella byssophila DSM 17132]
    MTFQEIINQDKPVLVDFFATWCSPCKMLSPILEDVKNRVGENAYIIKIDVDKNPQAASAYQVRGVPTLILFKNGKPLWRQ
    SGIVPATELENLINTNR

    >gi|312129720|ref|YP_003997060.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MFGIFKNLFVKTDNNQLTEAIKDGAFLVDVRTPAEFSAGSVKGAINIPLDKVPSQLSKFKNKKSIVVFCRSGNRSGQAKS
    ILENNGFQNVINGGTWQNVKQWTAEN

    >gi|312129721|ref|YP_003997061.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MKVEQIYTGCLAQGAYYITSNGEAAIIDPLRETLPYLDRLEKDGVKLKYIFETHFHADFVSGHIDLSKKTNAPIVYGATA
    KPEFEAIVAEDNQVFELGNVKIKVLHTPGHTMESSCFLLIDENGKETALFSGDTLFLGDVGRPDLAQKAANLTQEELAGL
    LYESLYNKILPLPDDVTVYPAHGAGSACGKNMMKETVDTLGNQKKINYALNQPNKEAFIKAVTDGLLPPPAYFGMNVAMN
    KKGYDSFDEVLTQGMKALSAEEFETIAESTGALILDTRSDKEFAKGFIPQSVNIGLNGDFAPWVGAMIVNVKQPILLVTD
    NGKEEEAVTRLSRVGFDNVLGHLAGGFETWEKAEKETDTVNRNTPEQFASEVKIGESKIIDVRKESEYAAEHIEEAYSKP
    LAYINDWVKDINPQEHFYLH
    CAGGYRSMIAASILQARGYRNFTEVEGGFNAIAQTNVPKTDFVCQSKLINS

    >gi|312129864|ref|YP_003997204.1| thioredoxin [Leadbetterella byssophila DSM 17132]
    MANNALEITDNNFQEIISSDKPVLVDFWAEWCGPCKMIGPVVEEIAGEYQDKAVVGKMDVDANSAIPAQFGIRSIPTLMI
    FKGGELVDKIVGAVPKHVLVQKLEAAL

    >gi|312129901|ref|YP_003997241.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MRLIFLTLSLLLHSVAQGQDLFRLTGKILNPQQDYLTFTYYADWVSEPREYTLTLNKDQEFLVEFPLKEMAYCDISFGEH
    GVHLLKIEPGDSIHLMFDQDDFNNTLRVEGPGSHKWAYQLMLRQRFEVDEDGDRELSQFNSPRYFEITQKWLSLQNQLLD
    QQTSMVSPEFAALQKADILGKVKLFELGYLNNKNSSDSLLQLDWNQFPEHIKAKSIYMGQVADALVDNYLKNKRTSASRT
    LEYEYLKLLKDRIGTGLTEKVLATKLLQYLDTDGMSEEIKLLGEDFMYFAQNDEYKKVLATQFRRKEALAVGKAAPNFIV
    QNKKGKLVELKDFKGKNLVLGFYDDE
    CYLCHEDMRAMEFVQGFFRKKKDLLFVFINLSPRELYLQFIKNPSLLGTHLNAP
    DNSFIRKNYNTQLLPNYLIIDKTGKILANAVDEPRLDDGRSMIQDIEKLIYKP

    >gi|312129927|ref|YP_003997267.1| peroxiredoxin [Leadbetterella byssophila DSM 17132]
    MIQKGDKAPAFEAKNQDGKTVKLEDFKGKKLVVYFYPKDNTPTCTTEACNLRDNYHRFLKEGYEVVGVSPDSEKSHQKFK
    AKFELPFDLLSDKDLTLANAFGVWGEKFTFGKKYMGIKRTTFVIDAEGSVVDVITEVQSKIHADQILNS

    >gi|312129965|ref|YP_003997305.1| rhodanese domaiN-containing protein [Leadbetterella byssophila DSM 17132]
    MKEISKEELKDFKDSEIVDVREKIEFSNYNVGGRNIPAHELNYYIEDLKKEEKLVVVCSNGMRSSIVARVLEKKLATIPI
    FHLTEGLAL

    >gi|312129980|ref|YP_003997320.1| peroxiredoxin [Leadbetterella byssophila DSM 17132]
    MMKTWLIVIVSGAVAALVLSNIGLIKNIFSAKNGISTMEENFTHKGSFYDFTVDDLEGNPVDLSVYKGKKVVIINTASKC
    GFTPQYAEWQKFHEKYGDKIAVLGFPANNFMSQEPGSNEEIAEFCQRNYGVTFKMFSKVDVKGKDKAPLYRWLSEKDLNG
    WNDKEPTWNFCKYVVDENGNLTHFFESKITPDNEQFRKAVGV

    >gi|312129987|ref|YP_003997327.1| hi0933 family protein [Leadbetterella byssophila DSM 17132]
    MDIYDFLVIGGGASGYFAAINTKEKAPHLKIGIIEKQGKVLQKVKVSGGGRCNVTNGETDPKILSKNYPRGADFLETAFQ
    TFGSKDTYSWFEKRGVKLKTEKDGRVFPVSDSSQSIIDCFLRLAKGVDLFLKTRVENLERDGELWIIHCSDDSIFKAKRL
    LIATGSDSRIWSALHHLNFKIEPEVPSLFTFQIPEPELHELQGISFPNATVRAGKILQNGPLLITHWGLSGPAILKLSAW
    GAYALKEKDYQFDLEVNWLSEKDIRKVEADLKAKFAENPKKNVRMLPYGTLTQRFWNYICVRSGIGEFQKGAEAGKKQIA
    KLLENLTAAKYKVSGKSTFKEEFVTAGGVSLDEIHVETFASKQYPNLYFGGEVLNIDAITGGFNFQAAWTAGWIISSDVS
    KK

    >gi|312130014|ref|YP_003997354.1| thioredoxin reductase [Leadbetterella byssophila DSM 17132]
    MEKVDVLILGSGPAGYTAAIYAARAGLKPVMYQGMQPGGQLTITNDVENFPGYPEGIQGPAMMEDLRKQAERFGLDNRYG
    LATSVDFSTPLAHKVIIDETKEIEAKTVIIATGASAKWLGLESESRLNGLGVSA
    CAVCDGFFYRGKDVAIVGAGDTACEE
    AHYLSKLCKKVIMLVRRDEFRASQIMQERVKNTPNIEILFNTETVEILGDQGVNGARLKNNKTGEEFEISVDGFFVAIGH
    QPNTQIFQQYLQLDETGYILVEKGTTKTNVPGVFACGDAQDNVYRQAITAAGTGCMAALDAERYLAAH

    >gi|312130101|ref|YP_003997441.1| redoxin domain protein [Leadbetterella byssophila DSM 17132]
    MNVKNYVRALLCLYLTILLPICNVHAQAFKVGDTLPEELWNMPLQVVNHPEGKETITLKEYKDKLIILDFWATWCGSCIK
    SLDKMDSLQKEFAGKLVVVPITYESAIKAIPLILKRGLLLPSVVNDSILKQFFPHESIPHQVWIKDSSVMAITGPAYTFR
    ENIENVLKNKEVKIVMKEEEDPHFNPKDIIIPSETSFIESGLLRKTRFSGTRMGISSHGFYYYNTSIRHLFIAAYRNQFP
    FINAPNRIIVEASDPWKVNFPPKPTTTEEAKRYEKWKQENMYTYYLRFAKPQTRETILKMAQSDLQNYFGQIENLTAVIE
    KRKTLCLILKPSANRPQAYKAVNTFRIREFVDLQSAIPVIDETGNPPSRTPLNYENIPVDYENLKVFFSSLGIDLTKEYR
    DIEMMIIKDKQQ

    >gi|312130130|ref|YP_003997470.1| thioredoxiN-related proteiN-like protein [Leadbetterella byssophila DSM 17132]
    MNVFIPFNMKKMMVLLLLAAGSASAQNAKINWISLEEAFSKIQTTPKKVMIDVYTDWCGWCKVMDQKTFTDPDVVKYVNQ
    NYYAVKFNAESKKDVVLGGTTYKFNAANRAHEAAIALLQGKMSYPSIVYLDEKFGMIQPVPGYMEAKDFHQVITYIGGNH
    HLSEKFDSFKAGTYSKTYVKK

    >gi|312130140|ref|YP_003997480.1| rhodanese domain protein [Leadbetterella byssophila DSM 17132]
    MEENFDITAAQLKELLEGNEPIQLLDVRNPDEFEADNLGGTLIPLGDLPFELDQLESWKGKDIYIHCRSGARSARAKEML
    LAEGFEKVHNVLGGILAYREL

    >gi|312130144|ref|YP_003997484.1| peroxiredoxin, osmc subfamily [Leadbetterella byssophila DSM 17132]
    MKRKATAVWNGTLKEGSGHLTTASTVLNQTQYSFNSRFAEGIGTNPEELLAAAHAGCFTMKLSADLTEAGFKPEVLETQA
    TITFEDGKIALSHLSLKAKVPGIGDGDFQQIAKKAKDT
    CPVSVAFSFPLELEAILL

    >gi|312130165|ref|YP_003997505.1| electron transport protein sco1/senc [Leadbetterella byssophila DSM 17132]
    MKKILIALTSISIWACSRTADDLPVLGPEIDGVAHQIPDFTFVNQDGDTLTQEITKDKIYVADFFFSTCPTICPVMKTQM
    LRIYEKYKDQPDFLILSHSINPRYDTPEVLKEYKEKLGIHGHQWQFLTGNLSNVYELAQKSYLTSALEDSTAVDEGGFIH
    SGAFVLVDKDRHIRAIYDGTKDKEVDKLMADIDLLLKP

    >gi|312130241|ref|YP_003997581.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MKKWFLFCTLWSFAAVGQQKITVKMPLANPNQYVHLAHYYGSKQLSKVDSVKVGSDGLLRFQSPEGGWKGGLYMVLLSPS
    KFYDLVVSGKEDDIYMEFDTTDYVNSVKFKGSKENEVMFNYRKFLTQKMKVGESLQKQLGTETNPSKVSTLQRQLDALGK
    EVNGEIKRVIDANPDLFASKLLRANIEPEIPTEIPTLPNGKKDSTYAYRVYKAQFFDGLDFSDERMIRTPFLESKLERYF
    SNLVYQKTDSLKKETTKVLEMSKKNKDIYRYTLWYITNKYETTDVVGLDGVIIHLYENFYLKDADWLEQSTLDRFRERLN
    IMKPLETGKVLPELVLKDAEGKIYQLSQQKAKYTIVNFYSPT
    CGHCKDAAPALVKFQDENKSKGIVVWNVATDHERDLEE
    MKKFIKEYDTSRLINVYDPDKKYDFFTKYDVYSTPTVYILDEKKRIIGRRIPIEEVLNFIAHYEKNGL

    >gi|312130439|ref|YP_003997779.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MKKLILLCLVAVNAFAQNLPVEIQIKLTHKEAKGKVYLEQLNDRGFAEKKDSVEIKAEPFLFKTQIEEPGIYQLNIGNEQ
    LIGLLLDGGEKINVVADGIVDDDKAAKAVIDGSPTMKVFQELQSDHIVFTNKVREIDTKFKSTSNESSRQKLRDQYLNLL
    KEHNQNILDKVKSLGTSSAGILAANNFLDASVSGEYQAELAEKLMAEKNSSKLAMVFVQQVNKSRMGVPGVPAPDFALKD
    LNGKEVRLSDLRGKTVILDFWATW
    CGPCIMSFPGMKKAMEKFKDREDVAFVYINTFERVPAENTNSYVDNFVKRRGFEFL
    QTVMDVGNQVAFLYGVESIPTKFFIDKEGKFLHVSRGFAGSDEAVVEEISQWLAQ

    >gi|312130558|ref|YP_003997898.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MKKGIILIVSVLLLAFQNPGGYGIGDAAMDFKLKGVDDREWSLSDFSDAKGHIVIFTCNSCPYAVAYEDRIIALDKKYKP
    LGYPVIAINPSGESEQENLEAMKARAREKSFSFPYVSDADQKLYPVYGAVRTPHAFVLKKQDGKNIVKYIGAIDNNYENP
    EEVTDKYIEEAVDALLDGREVIRTRTVAIGCAIKPKK

    >gi|312130559|ref|YP_003997899.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MAKRILILLCFCFTKLNAQKVVNFDELMQDLPTDKFVVVNFWATWCGPCLVELPHFMEVNKEFEKDSSFEMILVSLDPLK
    QMDKVKKTIEKKNLKVKHYLLNDNARMNEWIPKLDPEWSGGIPATLFINQGKKVEFVDRMLKKDELQLIISKYKTQ

    >gi|312130694|ref|YP_003998034.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MNVKFYVRALLCLYLSLSLHHLAAQELKVGDTLPPELWSLPLNVISHPSGKETITLDEYKGKLIILDFWATWCNPCVAML
    PKMDSLQKEFAKQVQILALTYQTTKEVDEFMKKYTRRTARELKLTMVIEEKALHQAFPHIYIPHYVWVSPEGKVKAITGH
    EEITAEKIRSFLKNGETTLATKADPTSIAYDSSKPFLVNGNGGDGKNLVYQSVLTRYTEGLPDGFSIRLDSIGNGKLSLF
    NVPLHWYYLKAYGADSVWFGPSRTEVHMKDPHRVVYSDSCGPYEDWKNRYTYCYQLVLSAASRLNLFNALREDLRRMFPD
    IEATIEPRRKLCWVLSRLDGHKIPIASEGAYVSRMEPTGYTLQNGRLKGLVWNMNMFVLQQSAIPLIDETGITHKISLQI
    NARLNDMVSVSKELEKYGLQIIQEYRDINVLVLRDKEVK

    >gi|312131119|ref|YP_003998459.1| redoxin domain protein [Leadbetterella byssophila DSM 17132]
    MNVKFYVRALLCLALTYLLSFTPIHGQALRVGDAIPDELWDIPLQVVNHPSGKHTITLAEYKDKLIILDFWATWCGPCVA
    MLPRQDSLQKMFAENLQILPVTYQNEGEITDFMDRYTQRTGQKNTLPKVTNDSTLRRAFPHSYLPHYVWIQNGAVKAITG
    HEEVTSKKIRSVLKDGLTTLSTKADPKRIAFDKESPLLVNGNGGSGDNLIYHSLFTGYQKGLPSAYFLSQPDSIKGVKLT
    CTNLSRLTLFKNAFGERTWPISANQIMMEVKEPGRLTSALKGSPYLEWLDQGNGFCYELILPASRADQVFSIMRRDLDLL
    FPDYTAAVEKHLRKCYVLTRSGTGLPLVTRGGEPAVIHEQFRYKSINRPLGLLVRNLNMKFLQHSPYPILNETGFEGPVD
    IDIEANMSEIDDLNRALAKYGLKFMEEEREIDMLVIRDRKNP

    >gi|312131367|ref|YP_003998707.1| peptide methionine sulfoxide reductase [Leadbetterella byssophila DSM 17132]
    MRKWTLLFWIILLTGNAACSQKKHKDMSNLQEAVLAGGCFWCTEAMFKQLKGVDHVESGYAGGTVINPTYEQVCSGTTGH
    AEVIKIWYDPNVITFTGLLEVFFKTHDPTTLNRQGNDVGTQYRSAIFYRNEEEKKISEEIIKELDASGYYSDKIVTSLEP
    LNNYFAAENYHQDYFRVKGDQNPYCQMVVKPKLEKFEKVFKDKIK

    >gi|312131384|ref|YP_003998724.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MNTTKFLTVFILLSVQVWAQGEFTVTPEKPEAGKEITITYKPSSNVPAKIQAYEFRGVIQQALDISTKRTAGKYVATIKP
    DTSATFVYFQMTAGGALDNNKGDGYTIELYRNGKPRKNANIAKAYFYQYFGEEVGVSSDKEKALASYKKELDLYPENESV
    RLSILQLEMSLDAEKGKQLVNEEITRKRSLGLNKEDDYNHLSRLYSFLKDKEQIDNLTLEKKEKFPNGMWAAQEEVNKFS
    AEQDLDKKMSMLKVLEENAKTDPRYARYKDNKVYLRSEIVRTLTSAKKWDEVEKYLNELELTPDKIQEGESREILGRMYN
    SLAWNMYEDGKNLDLAEKLAKVATEDQMAKITQAEGKSENVLKPLKDSYSMYADTYAAVLLKAGKYQQGFDIAKVSVLDY
    SGGNYPDYNGIYAQLAEKVLKQEEYIPQLEKFVVNGKSNELIKEILQRNYKGAESFDVYYSKLGEQAKTKMKEDLLKKIE
    NKPAPKFALSNLDGSQVSLDELKGKTVVVDFWATW
    CGPCIASFPGMKMAQDKFKDDPNVKFAFINSWESSKEVKKDVAEF
    IKKGAYPFDVLFDLDNKVIESYGVSGIPTKFIVDKNGAVRFTSIGFSGSAEKLVDEISLMIDLVK

    >gi|312131393|ref|YP_003998733.1| dihydrolipoamide dehydrogenase [Leadbetterella byssophila DSM 17132]
    MAQYDVVILGSGPGGYVTAIRASQLGLKVAVIEKENLGGVCLNWGCIPTKALLKSAQVFQYIQHAADYGIKVENADADFN
    AVIARSRGVAEGMSKGVQFLMKKNKIDVIEGFGTVKPGKKVEVKAKDGSVSTVEGKHIIIATGARARQLPNVPIDGEKVI
    DYRKAMVLDKQPKSMIVIGSGAIGVEFAYVYASMGTKVTIVEFMPNIVPVEDEDISKELAKQYKKMGIDVHTNSSVEKVD
    TSGKGCVATVKTPKGEITLEADIVLSAAGIQANIEGIGLEDVGIATDKGKILVDKYYQTNVPGYYAIGDVVPGQALAHVA
    SAEGIICVEKIAGHHPQPLNYGNIPGCTYCTPEIASVGLTEKAAKEKGYEIKVGKFPFSASGKAKAAGAPEGFVKVIFDA
    KYGEWLGCHMIGANVTEMIAEAVVARNLETTGMEIVKSVHPHPTMSEAIMEAAAAAYGEVIHL

    >gi|312131421|ref|YP_003998761.1| iroN-sulfur cluster assembly accessory protein [Leadbetterella byssophila DSM 17132]
    MVTVSDIAKEKIFELREKEGKNDNHGIRVAVEGGGCSGLMYNLAFDAEQQPTDHIFEDKGIKIFVDKKSLLYLMGTELDF
    SDGLNGKGFHFKNPNATRTCGCGESFSV

    >gi|312131427|ref|YP_003998767.1| e1-e2 atpase-associated domain protein [Leadbetterella byssophila DSM 17132]
    MKIKEIEQVKCYHCDSLCEQETLHYDDKVFCCVGCKTVYEILSDNGLCTYYDFNDGTNLKAKNFQGKYDFLSNETICSSL
    LDYNSQNLAKVTLFIPDVH
    CSSCVWLLENFQKIKEGILTSRLNFIQKRLFVSYDPQKVTLKEIVELLATLGYPPSISFGS
    VKANEPKQNHSILLKIGVTGFCFGNIMLLSFPEYFKLDLQNAVDAQYQKFFLYLNFLLALPVFFYGASDFLKGAWISIKE
    NWKKTTNVLSVDIPIAMGITALFIRSTYETFIEQTSGYWDSLAGLVLFLLVGKWMQQVTYKYLSFEHDYKSYFPLAVKTK
    DGEFKNISELQQGEIVEIKHQELIPADSTVISGNALVDYSFVTGESAPIEVQEGESIYAGGRQLGTQIDIRIEKPVSKSY
    LTELWNNEAFKKEKSSRTSHFANIFAKYFTYIAIGIALITGIYWKINNPELMWRTVTAVLMVACPCALTLALPFAMNAAM
    SILGKNKFFVKNQGIIPLLAEIDTIAFDKTGTLTEGHTGQIAYHGQELNIEELKWVKSLTSQSLHPLSKLLTAHIPEATY
    SVSNFKEIRGHGIMGKVEGHALRLGSASFLQVKDREPGQVWIEVDGVIKGYYQIETKYRKNWDGVLNRLSQYYDLRLISG
    DGDRDKRVLAPYFSDMRFQLKPQDKLSYIQALDGRKVLMIGDGLNDAGALRQAHVGVALSEDINAFSPSCDIILDAEGFG
    KLGKFLSFSKASMLVVRAAFALSILYNFIGLGLATSGYLSPLYAAVFMPLSSMSVVLFAVGSTYLFAKIKKLI

    >gi|312131562|ref|YP_003998902.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MALQIGDLAPSFTLYSSEKQEVSLSDYKGKKVVVLFFPLAFTGVCTEELCSVRDNIATYQNLNTEVLAISVDSLFSLEQF
    KKQQNLSFPLLSDFNKEVSAAYGALYDEFVLGMKGVSKRSAFVIDEEGKILYAEILEDAGQVPSFENIQKALQA

    >gi|312131572|ref|YP_003998912.1| redoxin domain protein [Leadbetterella byssophila DSM 17132]
    MKKLLALLLPIQVFAQNPELWKLQIKSPGGLIPSHILIEGDKAYAINADEKLEFDHVSKVRDTLHLKLELYDMELIFHPA
    SKQGFFSKKGADQSFRQAAFTAIPNEKIRFKGKPATQKLSKRYQVTFTNPETGKESAAIGVFETQNNEVKGSFLTSTGDH
    RYLQGNVIGDSLFLSTMGNSATLYKVRIKGDSLVGGTSFNPFGRGNNFSGVASETYQLPDADKLTFLKEGYEKFDFTFKD
    IQGKSVSLSDPRFKGKITVVQILGTW
    CPNCLDETKFLLEYKAKHPDIEVIGLAFERSSDPASAHPKIARFIERFKVDYPV
    LFAGSTAEAGDKLPQLNHVMAFPTSIVVDKKGQVRKIHTGFSGPGTGKYYEEYVKEFSAFVDQLRRE

    >gi|312131627|ref|YP_003998967.1| thioredoxin [Leadbetterella byssophila DSM 17132]
    MNSFFQKINSEQLTLVDFYATWCGPCKTMAPILSDLKKKVGDAATILKVDVDANPAISQQYRIQGVPTLILFKKGQILWR
    QSGVVALPQLEHIIHQYQA

    >gi|312131628|ref|YP_003998968.1| redoxin domain protein [Leadbetterella byssophila DSM 17132]
    MKKLILLALLFNSCISKQDQTQETDTEKVASTEHDLSFTKLDGSKVQLASLKGKVVLINFWATWCPPCIREMPSLQSLYE
    KYRQNPNVEFLVVEVDNKPELAKRFIEDKGYTFPVYSPDDILPETLLGQAIPTTVVLDKAGEIVIRHEGMSDFMADDFLN
    RWEGILAKP

    >gi|312131631|ref|YP_003998971.1| proteiN-disulfide reductase [Leadbetterella byssophila DSM 17132]
    MRFFVALLFISFASFGQGILKPTEWSYSIKPKSAKVGDEVDIIFNAKIQQGWKIYAAESDPDAGPMNLEFAFSKLQGLQL
    VGRPKPAKPAKKFYEEVWEADVLVYYNEATYIQKAKITGTDVKLHAALRFQTCQDDGVCIPGDEEYDISFKAEPGVEVKD
    VEKEEVSDTVATPEVVASLDTISAEPLQVLTDIPEAPDNKSGGMWQFLLVAFGAGFASIFMPCIYPIMPMTVSFFTKQKG
    GKFKAIFYGISIMVIFALMGLITMALGASFLNALSTHWIPNLIFFLLFIAFGFALLGAFEIVLPHGAVNKIDRLGDKGGL
    IGIFFMALTLVVVSFSCTVPFVGSLLIGAAGGEVLKPLYGMLAFGLPFALVFGGLAMFPQLLKNLPKSGGWLNELKAVFG
    FMEFALALKFLSNIDLAYHWNLIHRNVFLVIWILVAVIIGLYILGFIRLSKDEKVEKYGALRVFFAVVFFGIAGYMLPGV
    TNKPLSALSGILPPLPTQTSSAVAPKPELMRALPHGLWGFNEIEDALAHSAEVGKPVLIDFTGYA
    CANCRKMEENVWSKP
    DILKSLSEDFVIASLYVDDKKELPVERQYVSTYDNKLKATIGAKNLDFQMSKYNSNAQPYYIIVDAKGEMITPPVAYTSY
    EEFKAFLERGKKN

    >gi|312131676|ref|YP_003999016.1| hypothetical protein Lbys_3001 [Leadbetterella byssophila DSM 17132]
    MKKFLFTLVGVLFFAAASHAQGKLKFNKMVHDFGKVKEAGVITYNFEVTNVGNAPVVITNAQASCGCTTPEVPKEPIMPG
    QTKTIKVGYDTKGRVSAFNKTITVISNAENSQEVLTIKGEVLPKSKVSSK

    >gi|312131772|ref|YP_003999112.1| hypothetical protein Lbys_3097 [Leadbetterella byssophila DSM 17132]
    MLSLLFYLLLQWGTNLESALDQAKKEEKLVLLNFSGSDWCAPCIQLKKEIFESDEFKGVAEARLVLVRADFPRMKKNQLP
    AEQKAYNEQLAERYNPHGKFPLTLLLNPEGKVIQTWDGYTKSISKEKFLETIQKAK

    >gi|312131801|ref|YP_003999141.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Leadbetterella byssophila DSM 17132]
    MALTPSNMLNLGTVAPDFSLIDTRTAKITSLSDCKGAMGTLVMFICNHCPYVIHVMPEIMKVRQDYPQVGFVAISSNDVV
    SYPQDGPDKMREFAKEWNMDFPYLFDETQQVAKAYDAACTPDFYLFNAEDKLVYRGRLDESRPRTEDPKPLTGKDLRGAI
    NALLAGEPLSEIQFPSMGCNIKWKV

    >gi|312131979|ref|YP_003999319.1| arsenate reductase-like protein [Leadbetterella byssophila DSM 17132]
    MDTVKIYGIPNCDTVKKAITYLKDNQVPYIFHNFKTDGISPEKLKEWFETFGFNKVVNKSSSTYRALEDKSLVETPESAI
    KILQATPSMIKRPILENGNNKRIGFKKEEYDELFLK

    >gi|312131980|ref|YP_003999320.1| thioredoxin domaiN-containing protein [Leadbetterella byssophila DSM 17132]
    MKLVLRFCFVLLPFLGNAQGIKWEKSLHAAFAKAKAENKVLFVEFYSPTCPHCKKLAPILNDPTVAGLYNGNFVNYALDV
    DSEEGRNFAKKANLEVYGIPYFLFFRGDGTLIHSREVSAEVASVLQPGKMVLERTYTAEFYPKRFASGERSENFLSHYAI
    FSRVKKDSMTNFKLVDALWSIYPVEKREASWNLFKKISTDTENGFARFWIQNHKKSNDTPENVKAQFTRLLHGTLFGPRK
    FENWDQLAAEYGPIVGQKEVDALLWEKRTEIAWKKGEDHKALQIAQNVSKQFDAGGLLYLCRVFNQKGKNAEAVQQWLKK
    VAASPTYNKVEYFYQNALLEKNRGNKDQAKVWVQKALTSAKATKASTIELERFLKEL

    >gi|312131981|ref|YP_003999321.1| thioredoxin domaiN-containing protein [Leadbetterella byssophila DSM 17132]
    MRIAYLLLFLTFAACKKENKTSEDSGVVDTKTVTWTSDISEALAKAKATGKLVFVECYSPTCPICQSIEPYFSTSEVATK
    YNSEFVNYKLDVGVAEQVKFLNDHNIWLPSFPQFLFFDGDGNLVHQAEVTPSTASLVAAADEALSTDKRASLYKSRFDAG
    ERDFDFLVKYGVYTRLVKDTLENLKVGEALFATFDQNELGSETSWAVTKKVVTSVDNGFFKYWIDQMPKAAAYEKAQGHD
    GQELNTLGGIVQASIFRDGRKYSTQKIAVVKDYIRKVGGGDYADTYVWEQETLANLREGKPQVALNIGKSMAAKFSNNGP
    SLVYIAKVFNDNFPNNSYLPVAKEWLSAASNLVGEPAQQAEWHFEWARVHQKEGDLKNASERAKQAQKMAETAGLDLKKF
    KNLVNTLRNV

    >gi|312131982|ref|YP_003999322.1| hypothetical protein Lbys_3317 [Leadbetterella byssophila DSM 17132]
    MYRVLFCLLWLSTGVFGQQGIQWEKDLSDALAKGKSTGKLVFVEAYLPTCPACKAMDPQFQNADVAKFYNQNFINYKMNL
    SIEGARGFLDERKIEIPSFPQFLFFNGEGELVHQGETVPTPAGVLSIGREAKDPSLWSSNFVKQFELGNRDFDFLIKYGN
    YARVSRDMAASKKITEAIWANFNREEIGSNVSWQITKKVVNDTDNEFFRYWIDHMPEAAALEKAEGHEGQEGQVLGRILQ
    QTIFSPESKMFPIEKVNQLEQYMGKVGAGMYADAFLWEHRVRAYLRDGMKSTALQEGEKAVELYKQNGAAMLYVVQVFTS
    HVPEFVPLTLTWLQRAYPMLKENNYLAEYFYQMSVVSRKRGNVEESKQFAEQALEKARLAELQLDKFIIQASQD

    >gi|312131984|ref|YP_003999324.1| 1-cys peroxiredoxin [Leadbetterella byssophila DSM 17132]
    MSLRLGDIAPDFTANTTQGQIHFHEWLGDSWGLLFSHPADFTPVCTTELGKTALLKGEFEKRGVKVIAVSVDDLDSHNRW
    IPDIEEVNQVQFNFPIIADEDRNVAQLYDMIHPNASEKATVRSVFIIGPDKKIKLTLTYPASTGRNFQEILRVVDSLQLT
    ANYSVATPADWQQGDDTIIVPAVSTEDAIQKFPKGVKIVKPYLRYTPQPDKD

    >gi|312132024|ref|YP_003999364.1| dsba oxidoreductase [Leadbetterella byssophila DSM 17132]
    MKIEIWSDVMCPFCYLGKKHLEAALEQNQEDVEIEWKSFQLNPQLAGPPVSTLEYLSNAKGMPVEQISASFGPLKEAGKN
    FGIELNFENAQIVNTRPAHRFIQWAKAQGKGDAAEEMLFYSHFTLGENVGDLHILNRISDELGLGDASEAQTNPLYDQAV
    DKDLLEASQIGVRGVPFFVFNNKYAVSGAQPVEVFKEVFEKLKEN

    >gi|312132151|ref|YP_003999491.1| dihydrolipoamide dehydrogenase [Leadbetterella byssophila DSM 17132]
    MQYDVIVIGSGPGGYVAAIRCAQLGFKTAIVEKYPVMGGTCLNVGCIPSKALLDSSEHFYNAVHHFEEHGITTGKVKADL
    SKMVERKGGVVKKMNDGINFLMKKNKVDVKYGFGSFLDKNTVKVKKEDGSEEQIQGKNIIIATGSKPTILPFMNYDKTRI
    ITSTEALSLKELPKHLIVIGAGVIGAELGSVYARLGSKVTFVEFADSMIPTMDKALGKELQKSIKKLGAEFHFSTKVTLI
    ENLGKEVKVTAENKAGEKVEITGDYCLVSIGRRPYTDNLNLEAVGVATEKGRVLVDEHTLQTNVPNIYAIGDVVRGAMLA
    HKAEEEGVLVAEVLAGQKPHINYNLIPGVVYTWPEVAAVGKTEDELKAAGIAYKSGQFPFKALGRATASGDVDGFVKVLA
    DKSSDEILGVHIIGARAADMISEAVIAMEFRASAEDIARSSHAHPTYTEAIKEACLAATENRSIHM

    >gi|312132207|ref|YP_003999547.1| hypothetical protein Lbys_3546 [Leadbetterella byssophila DSM 17132]
    MKRLILLFLIISFSAASQTKPKIYHPEADAQAELNTAIAKAKNSGKHVFVQVGGNWCSWCLLFHDLVQKNDTLSTYMKDN
    YEVLHLNFSPENKNEETLAKLGYPQRFGFPVFVILNGDGQRLHTQNSAYLEEGKGHSTKKVFGFLQDWAPAAVSPATYSK
    K

    >gi|312132226|ref|YP_003999566.1| copper-translocating p-type atpase [Leadbetterella byssophila DSM 17132]
    MKIDIPIQHIPDENLLKQRLSAVPDLQNFNITNNSISIDADKYPEEVVQAVAQILKDVGIKLSSATQNWPVMGMSCASCA
    SSSEATLNNQVGVIQAQVNYASGKATVEYIPELIQPTNLKTALQSAGYDLLIEQEDVSQIKESEASTLKKKLLGALILSV
    PLFVIGMFFMHMPYANYIMWALATPMLFYFGRQFFIGAYKQFRHKSANMDTLVALSTGTAYVYSTIITLTQEHGHVYFEA
    AGIVIAFILLGKWLEERAKGNTSSAIKQLMGLQPKTLTIVAEDGTTSILPIQQVQKGQVILVKPGEQIPVDGEILSGESY
    VDESMITGEPVPVRKGKADSVYAGTLNQKGSFQFQATKVGSETLLARIIQTVENAQGSKAPVQKLVDKIASVFVPTVISI
    AVISLVFWGLMGNWSQGLNAFVTVLVIACPCALGLATPTAIMVGVGRGAQKGILIKDAESLELTQKMNALVLDKTGTITE
    GQPSVTRIQWIQEPSELWKDLLYSIEKRSEHPLADAICKHLEGRFLSNLEVENVSGQGIIGFWEGQRYRVGNPEWIKVEL
    TDTQKAQFKSHLDLAQTVVFFADDTRVLAIIGIRDKIKSGSKAAIERLQKDGIEVYMLTGDNEATAKAVSYEMGIKEYKA
    QVLPELKGEFIKRLQSEGKVVGMVGDGINDSQALALADVSIAMGKGSDIAMEVAKMTIVSSDLQKIPEAIEVSKLTGRAI
    KQNLFWAFIYNVIGIPIAAGIFYPEFLLDPMWAGGAMAFSSISVVLNSLRLR

    >gi|312132249|ref|YP_003999589.1| peroxiredoxin, osmc subfamily [Leadbetterella byssophila DSM 17132]
    MKRSAKAIWNGNLKEGKGQLSTQSQALSQTPYTFVSRFDEGKGTNPEELIAAAHAGCFTMKLNADLSAAGYLPTQIETTA
    EVTLIQGIISQSALSLNANVPGLTLEDFQNFALEAKAN
    CPVSKVLNLEITLNIQSFNGINI

    >gi|312132254|ref|YP_003999594.1| disulfide-isomerase [Leadbetterella byssophila DSM 17132]
    MRRIGFIIFLLGSNLAFAQNSGIDFESTKWKEVVKRAKEENKLIFFDAYTTWCSPCHKLQNQVFPDKTLGEYYNRNFINV
    KYDMERGEGITLSRKYTIQVYPTLLFIDPRSEKVVNHAIGFKSVEQLLQLAEQAMSRTNW