Lawsonia intracellularis PHE MN1-00

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94986468|ref|YP_594401.1| O-6-alkylguanine-DNA/cysteine-protein methyltransferase [Lawsonia intracellularis PHE/MN1-00]
    MLLSSQHEVIQEYISGEILTLTIYSVNNLINQIDIDWLKNPFNPTTTIGKQVKNLLLSYEQGKLVQWDLLPLNWNSIPKN
    SFQKKVLLTLTTIKYGTTISYRDLAALAGNPRAARAVGNIMSKNPWPLVVP
    CHRVIGINNHLTGFKGKKGLSIKAWLLHR
    EGHLISNNKSIIS

    >gi|94986564|ref|YP_594497.1| peptide methionine sulfoxide reductase [Lawsonia intracellularis PHE/MN1-00]
    MVSKQKMSKEDAYFAGGCFWGIEDVFQNTPGVIDAVSGYMGGSTKNPTYEQVCTGQTGHAETVHVHFDSMQVSYKDLVKL
    FFEIHDPTQYNRQGPDIGTQYRSVIFYANELQKDIAEQIIKQLKQTNLPIVTQLLPVSTFYPAEEYHQNFTEKTGRGGCH
    LRVKRF

    >gi|94986565|ref|YP_594498.1| methionine sulfoxide reductase B [Lawsonia intracellularis PHE/MN1-00]
    MKPLSDKEAWIILHKGTEPPFSGKYVNHKEEGTYICRQCGAVLFNSKDKFDSGCGWPSFDDTIPNAVKQLPDADGYRTEI
    VCSTCNGHLGHVFEGENFTQKNVRH
    CVNSLSLLFEPSIELSQNKNHTNGEQTENE

    >gi|94986810|ref|YP_594743.1| thioredoxin reductase [Lawsonia intracellularis PHE/MN1-00]
    MKQYDSIVVGGGPAGLTAALYLCRSGLSVALIEMLAPGGQLLKTEEVTNYPGFPLGIKGWELADFFSAHLDGYTLTRYND
    NVTSFIHTPGENKLTVGEKDIIGKSIIICTGASPKMLGLQRESELRGRGVSY
    CALCDGNFFRDQVVAVVGGGNTALEEAL
    YLSRIVKKLYLIHRRDKFRANKHYQDKIMATTNKIKLILDSRITMLHGESELEALEVENVKTQVISKIEVSGLFIFIGYE
    PKSDFLPSELALDASGFVLTDSEMRTNLPGVFAAGDIRSKQCRQVVTAVGDGATAATAAFSYIEQLDV

    >gi|94986811|ref|YP_594744.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia intracellularis PHE/MN1-00]
    MAAQVTDTNFDTIVLKSNKPVLVDFWAPWCGPCRAIGPIIDEIALEYASDIHVVKLNVDENTITPGQYGIKAIPTLILFK
    NGEVVEQLTGAVSKTSIITMLKEKALS

    >gi|94986876|ref|YP_594809.1| hypothetical protein LI0433 [Lawsonia intracellularis PHE/MN1-00]
    MRQYRIIYLLLFYFIFCLSISHPVAADITYSPLDVKFAYALDTGTSPETVIIKMVLTVDDNYYTYTHNEKEGLPTKVVLQ
    NSSGTILQSRIFYPEGEIHEDVSSGISIKKVYSGEFPIFLQVQRDALTPESEVQLSLLLCSSKHCMPVNRTIPITLPNPL
    PSIDEVPWEDTYLLYTNPVVHTAESEHLIDSTEQTTDIAESLFPWDLHPRYFQSGLEPTRIELALLFGFLAGLILNIMPC
    VLPVLTLKFSFILSHLGYKGEHCFRYVREQNLLFAAGILSWFVMLALGVEVLELAWGGFFQSVPVVYGLMLIVFILALSL
    FGFFTLPIIDFKIETTSFPRIQAYFTGVMTTLLATPCSGPLLGGVLGWAVLQPFYIIFIVFLATGLGMSLPYIIFAFKPQ
    AIRFLPRPGAWCGTLEQLVGFFLLGTTIYLLSILPETMLIQAIVTLLIAAFAVWCWGVLGGLSVSSTQRVVVGVVVSCMI
    AMSVWWSFHPAEKAHWLSYSDTKFRKELGLTPMLVEFTADW
    CPTCKLLEKTVLTTSFLEQLVNEYGIKLIKVDLTNKHSE
    AEALLRALGSVSIPVTAIFPSGEKANQPLVLRDVYTSEQLEKALQLAIKSSE

    >gi|94987038|ref|YP_594971.1| peroxiredoxin [Lawsonia intracellularis PHE/MN1-00]
    MVKERKDIITFLGNPLTLMGNPVSIGEKAPDFTVLANDLSPRTLSDYANNILILSAVPSLDTGVCDIETQRFNSEAAKLG
    EKVRILTISCDLPFAQARWCGATGVSAVETLSDHRELSFGYAYGIAIKELRLLARAVFVVDTNGMITYQEIVPEMTHEPN
    YTAIFEAVNTAS

    >gi|94987040|ref|YP_594973.1| cation-transporting ATPase, P-type [Lawsonia intracellularis PHE/MN1-00]
    MTYTIHNLHCRGCAIRIEEQIQSLPGISFASIDELTHHLVIEGSAPDLIELNKIAGEILPGVYFEPYSTNAIDEEVSWPP
    SLWIASLFFIIGILFQEKLYKFSLSVVTDAIFFGIPYVLCGWSVLLQGLKCVLRKDFFNEFTLMGGATLIAIALGDFSEA
    VGVMFFYRIGEYIQERTLIKSKKSIRALLATKPSIAHLVQKNHIQDVSPESLQPGANLLVRPGEKIPLDGIVESGTSQVD
    TSPLTGESVPTVVHVGSQVFGGTINIMGSLIIKATATYKDSSISRMLELVENAVARKAPTERFITRFARYYTPLVVLSAI
    LVAILPPLFGLGTLQEWIYRGLILIVISCPCALLISIPLGYLGGIGAASRQGILVKGGSVFDALQKIKIVAFDKTGTLTK
    ARFEVTGILLNKGVSREYLLQSAAMAVTYSSHPIVRPILDIVNQKPQVSGIALKEIPGKGIVATYKETSLVVGNETLLRE
    HGFEPIIVDRPGSIIHVARDANYLGVIVVTDTLKSDAVEAIRCLKKYVNKVVMLTGDRPDSAEGIAKIIQVDEYRAGLLP
    EDKVAVIESFGPIEQTLFVGDGINDAPVLAYSGVGVAMGKLGAESAIEVADAVILDDSPVRVVDLIRIARKTYIIVLQNI
    ILALGIKTVIMGFGIAGLSTLWEAVFADVGVALLAVFNSTRAGKLKNF

    >gi|94987056|ref|YP_594989.1| Thiol-disulfide isomerase and thioredoxins [Lawsonia intracellularis PHE/MN1-00]
    MYTIRTIFLYTLFIALTHISLAHAEEIKTIQGKELAYFISQNKGKPIFITVFATWCPACRQEMPGIIATQQKYSKEQVTF
    IGISLDDNVENLQNYIKQSKITFPVYIAGSTIPSMFSITAIPHNIIYDKKGTLVMNKAGALSANELNTMLNKYIK

    >gi|94987093|ref|YP_595026.1| rhodanese-related sulfurtransferase [Lawsonia intracellularis PHE/MN1-00]
    MSKRVIIIGAIAAGPKAASRLRRLEPTTEILMVDKNEYISFGACGIPYYISGEINSIDSLRSTAYGVLRTPEYFQQKGIT
    TYNRTQAISIDRKQQIVLLKHLLTNKEYTVSYDKLVLTTGSKPKLPTIKGQHLKHIVTISNTSLDSAQHIQTLCASKKIK
    HAVIIGGGFIGLEMAVSLAGKWKIKTSIIEVKPQVMPGYVSPDFADMLCHDLTKNNVEIFTSEQVLQFKGKNDSVNYLIT
    DKRKIETDLVIFATGFLPETTLAQEAGLALDPKTGAILVNPYMQTSDPNIYAGGDCVAVPNPITGEHSWFTLGSLANRQG
    RIIGTNLAGGSDTFPGAVGNWCIKLFTLSACGAGLTLEKAKSLGFDAISASIEQADRSQSYPEHSIISLELIVDCSNRRV
    LGIQGICSASDVVKARIDAITMLLQYGHPTIDDISNAEMSYAPPFSSAMDPINVVANVADNILSGQLESVTSKTFTTMWN
    DRKNNTIFFVDTRPTTASKELKEKYPNEWHTIPFEEISSYLSELPKTQPIALI
    CNTGLRAYETMSYLRGKGITNTIDVLG
    GMYAIKKRGEEL

    >gi|94987150|ref|YP_595083.1| protein-disulfide isomerase [Lawsonia intracellularis PHE/MN1-00]
    MLFSFRFITYPLITIFILYTCHNALASNNDSMITSENFESQLRLLLHNHPELVLDVLREHSELVLEIAQQGSKQRQHKSL
    IAQWKKDITTPKNMHLENRPIRGNPKAPVTIVAFSDFT
    CLYCSQASKTVQQMLIDYKDNVKYIFKHFPLKGHTISQQAAI
    YFIAASFQSNEKAWALYDLLFQKRDELLQNGEQTLKQAVKEVGLDIKKLMSDLNKAEVNNILGQDIKDAAQLDISGTPYF
    IVNNLILRGALPPELFTEAINMALKNTKEVSTSPK

    >gi|94987292|ref|YP_595225.1| hypothetical protein LI0850 [Lawsonia intracellularis PHE/MN1-00]
    MTNNLSPKYDYEHDYDVVILGAGASGLMCGLTVAQKGLSCIIIDHSPTIARKLCLAGGGKGNITNLNLSPKWYVGENPIF
    CKDVLLQYSPHDIIDLLKKYNIPWEIRSHDQVFCKVKVAHFVKCLIDECKKNNVQFLLKNSIQKVSANPKSFVIKTSTQL
    LKTSNLVLALGSQAWPATGATDLGIHIAKQCCHTIIPTRPILVPFILQKNSPLQDLAGISLNVSITIGADNKKRTFHYPL
    LFTHKGISGPAALQASCFWEKGQTITINFLPHISLIDYMHSFSNTKQTVKSLLKNFFPTRFIDNFIPINLQSQKVAEISK
    KNRIWLSNKLHAYVESPLETEGIKKAEAMAGGVNTYEVNPHTLESNIIPGLYFSGEILDITGLLGGYNLHWAWASGYVVG
    KTIQR

    >gi|94987567|ref|YP_595500.1| copper-translocating P-type ATPase [Lawsonia intracellularis PHE/MN1-00]
    MLHSNLILLELTVSKQQTLNFIVKGMSCTSCSSRLERTLGNIPEIQSVTVSLNNSMATVIPIPEANIKKLIQEVISETEK
    TGFIANYLAEDLAEQKTWILQQESISHYLEELKQRLIIEFFFTILVLFISMGPMWGVPVPVFVNPKTYPLNNAIAQLLLT
    IPVIWSGRYFYLIGFSRLWKMSPNMDTLVALSTSAAIIYSIWSTIEISFGNYYTEPSLYYETAVVLITLISLGKYFEMLS
    RFRMSDAISRLMNLVPETALRLSSLSDQEESFEEVPLSNIKVGDIVQVRPGSKVPVDGKILKGSSSINTSMLTGESMPVF
    VTVGDKVIGGTINLSGMFLMHAEKVGLNTALAHIIRLVREAQGSKAPISRITDQISLIFVPVVIAIALVSGLTWLLLGDT
    SIADSIRIVMTVLVISCPCALGLATPMSIMIATGRGAQLGLLIKSGAALEYAADLDTIVFDKTGTLTEGKPHLIHTVPLK
    TMPDNELLRITASLEAVSEHPLADAIVRAAHKHGLVLYPVINFMSYPGRGVRGELQVKTESITVLVGNKTFLEEHHISLD
    NKVGITTLEEFAGQSFISLLVAINGQFSGIIAVTDPIREESNSVTEQLQHMGIRTIMLTGDSKQTAQIVANHLHLNEVIA
    DVMPEGKAYAIQELKNKGFRVGMVGDGINDAPALAKADVGIAIGSGIDIAIETSDIVLLNSLSTNHPLSGLVSALLLSRA
    TLRNIRQNLFWAFGYNIICIPIAAGILKLFGGPLLSPMLAGLAMALSSISVVLNALRLKKFTPS