Laribacter hongkongensis HLHK9 uid59265

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226938937|ref|YP_002794008.1| DsrE family protein [Laribacter hongkongensis HLHK9]
    MKRFLFIINASPYGEERFLSAVRLALMLTDPEQEPVALQVFLMSDAVVAGLAGQETGGTAQNLGVMLAELVEAGAEVRLC
    RTCLASRGLLDAQFVAGAEIGNLGQLAAWTRAADQVLTF

    >gi|226938946|ref|YP_002794017.1| rhodanese domain-containing protein [Laribacter hongkongensis HLHK9]
    MRTVSVRELADWLADAGRPAPCLVDIREPWETAMACLPGCVALPMAELLIRQAELPDDQPIVVICHHGVRSHYAALWLEE
    AGFGDVASLQGGLDAWSAEIDPDLPRY

    >gi|226938991|ref|YP_002794062.1| MoeB [Laribacter hongkongensis HLHK9]
    MHDEQLIRYSRHILLPDIDIAGQEKLLSSHALVIGAGGLGSPAGLYLAASGVGTLTICDDDTVDLTNLQRQIIHACDRLG
    DNKAESAVRRMRDLNPDICLRAVAERVEGQRLAALVAEADVVLDCCDNFATRHAVNRACVAAGVPLVSGAAVRFDGQLAV
    FDYRTPHTGCYHCLFPDEGETSDGP
    CALFGVFAPLVGVIGSLQAMEALKLLLGLPSQAAGQLQLLDGRSGEWRRMRLVRD
    PACPVCGKN

    >gi|226939006|ref|YP_002794077.1| Thiosulfate sulfurtransferase [Laribacter hongkongensis HLHK9]
    MDINTVAASLDDPGFVLVDARGADRWRGENETLDPVGGHIPGSRNRPFALNLAADGRFKPAGQLAQEWQALLGDATPAQV
    VNQ
    CGSGVTACHNLLALAHAGLPGSRLYPGSWSEWCRDPARPVARGA

    >gi|226939065|ref|YP_002794136.1| LpdA1 [Laribacter hongkongensis HLHK9]
    MALIELKVPDIGGHANVDVIDVLVQPGDAVAVDASLITLETDKATMDVPATTAGVVREVRVKVGSKVSEGDVMVVVESAD
    TATTAAAPVAEPAAAASPTPAAVTAPTPAPVRDGSDIDCDVLVLGGGPGGYSAAFRAADLGLKTVIVERYATLGGV
    CLNV
    GCIPSKALLHNMAVIDEVRHLAANGIRFAEPEIDLDALRAYKNQVTGKLTGGLAGMARARKVDVVRGEGRFVDPFHLEVA
    LTQGDGREQSGETRVIGFKHAIIAAGSQPVKLPFLPDDPRVIDSTGALKLESVPEHMLVIGGGIIGLEMGTVYSTLGARI
    DVVEMLDGLMQGPDRDLVKVWQKYNAHRFDRVMLNTRTVAVEAREDGVWVSFEGPDAPAEARRYDRVLYATGRAPNGRRI
    GAEAAGVAVDARGFIPVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAENCAGHKAFFDARVIPGVAYTDPEVAWV
    GLTEDEAKKQGVSVQKAVFPWAASGRAIANGRDEGLTKLLFDSESGRIVGGAMVGTHAGDMIGELCLAIEMGCDAEDIGK
    TIHPHPTLGESIGMAAEVALGSCTDLPPARRR

    >gi|226939071|ref|YP_002794142.1| hypothetical protein LHK_00137 [Laribacter hongkongensis HLHK9]
    MPCRCRWASCSPGIARIAPGLDTPMILYCASGMRSASGVRMLAALGYTGVHNAGGLGQAVAWARQRNSGT

    >gi|226939081|ref|YP_002794152.1| Methylated-DNA--protein-cysteine methyltransferase [Laribacter hongkongensis HLHK9]
    MPHRQGEGAGAENLLPQESLIHDGTPFTACRCCFCRPSGRLAGIGCRQGGRLRMLDLSACRSRMMESMETAARHYAVVER
    AIVWLNEHAAEQPSLSRLAQAVGLSDSRLQRVFSDWAGVSPKRFVQFLTLGHARRLLAAGRPVDATALAVGLSGSGRLHD
    LIVQHEALTPGELRRGAAGVPVGWGLAATPFGEALLAWTPRGLGYLAFVDDTPAAALAGCQARWPQAVWHEDAATAAGWA
    RRVFAPRAADDPLPVLLRGSRFQLKVWEALLGIAPGQRLSYGMLAQQLGQPGAARAVGSAVAANTLVVLVP
    CHRVIRDTG
    VLGQYRWGSTRKAALLVRESAAAQPELSD

    >gi|226939297|ref|YP_002794368.1| Probable methylated-DNA-[protein]-cysteine S-methyltransferase [Laribacter hongkongensis HLHK9]
    MPDCIVPMPWGGTLAIRVKDGALLSIDFLDAGTELHAPEHPVACQVRDAVHGYLSCPHQSWPSIVRYPQGSMFQQRVWAA
    IAAIPVGQTRSYGELARQLDSSARAVGRACGDNPWPLLVP
    CHRVVAANGLGGFNHDRGDGMLAIKRWLLAHEQGERQAEL
    F

    >gi|226939355|ref|YP_002794428.1| Glutathione peroxidase [Laribacter hongkongensis HLHK9]
    MTTVYDFSATRLDGSEQSLADYRGQVLLIVNTASECGFTPQYAGLESLYGQYRDQGFSVLGFPCNQFGGQEPGDSEAIGQ
    FCSTRFHVTFPLFAKVDVNGAGAHPLYRHLVKARPGILNTEAIKWNFTKFLVGRDGEVLARYAPTTRPEELVADIEAALE
    QPGS

    >gi|226939432|ref|YP_002794505.1| Glutaredoxin-like protein [Laribacter hongkongensis HLHK9]
    MRDVTAEIRQQITDNPVVLYMKGSAQFPQCGFSARAVQILKACGVDRPVTFNVLEDPEIRQGIKDFSGWPTIPQLYIKGE
    FIGGSDIMTEMFQSGELQPLVAEALAGH

    >gi|226939520|ref|YP_002794593.1| thioredoxin [Laribacter hongkongensis HLHK9]
    MAVQILTQANFNETVQSDKPVIIDFWAPWCAPCRMFAPIFEAAADKHPDILFAKVNTEEEQALASAFGIRSIPTLMVFRE
    QIMLFQQAGALPANGLEQLIGQVRSVDMDEVRRQIEAEKPGQ

    >gi|226939637|ref|YP_002794710.1| Bcp [Laribacter hongkongensis HLHK9]
    MQGTPCPDFSLPATGGTTFTLAAARKPLVLYFYPKDNTPGCSNEAQAFAALHADFEAAGCEVAGISRDSLKSHENFRAKF
    DLPFPLLSDPDETVCNLFGVMKLKNMYGKQVRGIERSTFLIGEDGRIEAEWRGVKVPGHAEAVLAAVRAR

    >gi|226939864|ref|YP_002794937.1| Putative iron-binding protein erpA [Laribacter hongkongensis HLHK9]
    MNAASEMPLPLNFTDSAVAKVSELIAEEGNPDLKLRVFVTGGGCSGFQYGFTFDEITNEDDAVMEKGGVTLLIDPMSYQY
    LVGAEIDYQESLEGSQFVIKNPNATSTCGCGSSFSV

    >gi|226939866|ref|YP_002794939.1| Probable peroxidase [Laribacter hongkongensis HLHK9]
    MAVLVNKTAPFFADDDKKFSAVLGNGQIVDDFSFKAATAGKYAVVFFYPLDFTFVCPSELIAFDHRLEEFKQRNVEVIGV
    SIDSQFSHNAWRNTPVNQGGIGPVGYTLVADLNHDICKAYDVESEGGVAFRGSFLIDKSGVVQHQVVNNLPLGRNIDEMI
    RMVDALQFFEENGEVCPAGWNKGKKGMKASTAGVAEYLAENAGEL

    >gi|226940021|ref|YP_002795094.1| SelD [Laribacter hongkongensis HLHK9]
    MMTEVKLTQLSHGGGCGCKIAPSVLEKILAGIRPVLPVPDLLVGIDTADDAAVYRLNDEQAIVATTDFFMPIVDDPFDFG
    RIAATNALSDIYAMGGKPLFALAIVGMPVNVLTPDTIRQILEGGQAVCAAAGIPVAGGHSIDSPEPIYGLVGIGVVHPDQ
    IKTNAGARPGDRLILGKGLGVGILAQAMKKGLLDEAGYAAMIASTTLPNVVGSELAPLASVHALTDVTGFGLAGHLLEVC
    RGAGLTAHVDMARIPVIREAEPYARQLIGPGAIERNRASFGHGIRFATDIPDWQQRLLTDPQTSGGLLAAVAPEAVDDVL
    ARFHAAGFDYACEIGSLTAGDAEIIVR

    >gi|226940146|ref|YP_002795219.1| NADH-ubiquinone oxidoreductase [Laribacter hongkongensis HLHK9]
    MQHGQPAPDLPAAESSPWKSIAFNGIWKQNAGVVQLLGLCPVLAVSTSIVNGVSLGLATALVTALSGAAVAAVRQWVPSE
    IRNPIFITIIAALVTMVDLAMNAWVHGLYNVLGIFIPLITTN
    CIVLARAEAFASKNPVRESAWDGLMMGLGLTGVLGLLG
    AMRELFGKGTLFSGIDLVFGPAAGALTLHLAPENYQFLLALLPPGAFLGLACLIAGKNWLESRRRAQSRPATVNGAASA

    >gi|226940151|ref|YP_002795224.1| electron transport complex, RnfABCDGE type, A subunit [Laribacter hongkongensis HLHK9]
    MDFGHYLLILVATVLVNNVVLVRILGLCPFMGVSKKLEAAIGMGAATTFVLTLASGTSHLINELLVAAGVDYLRTLAFIV
    VIAAIVQFTEMVIQKTSPVLYQVLGIYLPLITTN
    CAVLGVPLLNVQERHSFAESLVFGFGSAVGFSLILILFAALRERLE
    GADVPAPFRGSAIAFVTAGLMSLAFMGFGGLVK

    >gi|226940209|ref|YP_002795282.1| YcaO multi-domain protein [Laribacter hongkongensis HLHK9]
    MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCDTRNIPTEHIRLSQNNIVDPE
    NRYQQTFKIQVELPPDISEKDRQGILRSIERCTVKKVVQTGPEFIIEEVENLDADAQALLTINPDTGKQTYIAGKDLPLE
    ETIANMSGLLAGLGIKIEIASWRNLVPNVWSLHIRDAHSPMCFTNGKGATKESALASALGEYIERVSCNHFYNDQYWGEE
    IANAPFVHYPNERWFKPGKKDALPEGLLDDYTLAIYNPDGELRASNLFDTNSGNTARGICALPYVRQSDGETVYFPTNLI
    DNLYLSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEITLPDVPAEVLAQYPGIVAGIEELENQGFPVLVKDASLGGE
    FPVMCVTLMNPRTGGVFASFGAHPSMEVAIERSLTELLQGRSFEGLNDLPRPTFESHAVTEPNNFVEHFIDSSGVVSWRF
    FSAKADYDFVEWDYAGQGETSNADEAATLFGILEGMGKEVYMAVYDQLGATACRILVPGYSEIYPVEDLIWDNTNKALAF
    REDILNLHRLDDNALEALLERLEDSELDDYTDIITLIGVEFDENTDWGQLTILELKLLIQLALKQFAEAHDLVGAYLQYN
    DNTVERGLFYQALNVVLEVLLDDDLELADYEVNFRRMFGNARMDAVMGSVEGSVRFFGLTPTGMNLEGLDRHQRLIDSYK
    KLHKARGTGVATRKT

    >gi|226940294|ref|YP_002795368.1| Trh1 [Laribacter hongkongensis HLHK9]
    MDTVRKTDTEWQAQLTPEQYYVTRQAGTERPFSGPFYRHTERGRYRCVCCGALLFASSSKFDAGCGWPSFWEEAEPGAIR
    RLRDTSHGMIRTEVRCVRCDAHLGHVFEDGPPPTGERF
    CINSAALVFEAADPAP

    >gi|226940304|ref|YP_002795378.1| Probable cation transport P-type ATPase [Laribacter hongkongensis HLHK9]
    MTESCFHCGLPVPAGADFPVRYRQSPHATCCAGCQAVAQTIIDAGLDDYYQHRTEDARRAEPLPADLLEQIRLYDAPELQ
    QSFVHCEGDEREAALMLEGIT
    CAACVWLNEQHLKKLPGVLSVDVNYSSLRARVKWDDSRIHLSQILEAIASIGYRAHPYD
    ADRQEKLAQQERKSQINRLWVAGLSMMQVMMYVVPTYLAPDGDIDPQWLWMLHWASLVLTLPVVLYSAWPFYKGTWRDLR
    SRRVGMDVPVTIGILTAFFASCWALFRHIDHGIYFDSVSMFVFLLLGGRYLEGIARRRAGDAAERLVKLIPAFTHRLAGW
    PASREAHVATVASVRSGDVLLIKPGDTLPVDGVVLEGESSLNESLLTGESLPVRKQAGDAVIAGSVNTASPLVIETSHVG
    ETTRLAGIVRLLDHAMAQKPRLAVLADRVAGWFVAGLLLAAAAAFWLWYGIDPDRALWIMVAVLVISCPCALSLATPAAL
    TAAGGALADHGVLLARGTALESLARVTDAVFDKTGTLTTGVMQHNATSLLDPQLTEAEALTLARGLESGSEHPIARALLA
    TGESVPLATGISNHVGAGVEGRIDGRRYRLGKPEFVAELTGTPLAASEAFGGTDSIVALGSDTGWLALFAIGDRLRDEAR
    AMVDSLHARGIRVHLASGDSQRVVDGVAGRLGIEDARANLTPEAKLALVTRLQAEGRTVLMVGDGVNDAPVLAQANVSAA
    MGQGADVARLSGDIVLIGEGLTPLLPALTIARRTRTIIRENLAWAVGYNVVALPLAFMGWVTPWLASLGMAASSLLVVGN
    ALRLSRQPASRTVRPKD

    >gi|226940363|ref|YP_002795437.1| Electron transport complex protein rnfA [Laribacter hongkongensis HLHK9]
    MSTEPLWSIFLNAAIVNNFVLALFLGICPFLGVSSKLRTASCMGAATLFVMLICALCAWAINLALAWLGLESLRLIAFIT
    VIASTVQLVEMVIRRFSPALFESLGIFLPLITTN
    CAVLGLALFQTARQYSLLQSLVFALGAGAGFTLALVLMAGLRERLS
    LAEVPDVSQGAALSLMLAGMLALAFMGFSGLGA

    >gi|226940364|ref|YP_002795438.1| Electron transport complex, RnfABCDGE type, E subunit [Laribacter hongkongensis HLHK9]
    MSEADNKAGLAPGTFSEGLWRNNPVFVMLLGMCSVLAVTNSAVNALAMGLSTTFALVASAAMVSGLRRLIPRPVRIATYV
    VIIATFVTLIDYAIQVISLALYNALGAFIQLIVVN
    CLILGRAEAHASKNRVWPAVVNALGMGLGFTLALLAMGTVREILG
    SGSLFGVRLFGESFAPWVIMVLPPGGFFVLGGWLLLFSIIKHRRQARQQQLEVQHVH

    >gi|226940386|ref|YP_002795460.1| thioredoxin [Laribacter hongkongensis HLHK9]
    MAPQFTLYYRDYCSLCHAMRDALKPYVAAGQLALEIVDVDADEALVARFDELVPVLVGPDGHEVCHWHFAPERLAAYLAE
    IG

    >gi|226940406|ref|YP_002795480.1| TrxB [Laribacter hongkongensis HLHK9]
    MSQTRHSSLLILGSGPAGYTAAVYSARANLNPVLITGLAQGGQLMTTTEVDNWPADAAGVMGPELMQRFQQHAERFGTEM
    IFDQIHTVELRQRPFKLTGDAGEYTCDALIIATGASAQYLGLPSEEAFMGRGVSG
    CATCDGFFYKNQDVAVVGGGNTAVE
    EALYLANIARHVTLIHRREAFRAEKIMVDKLMEKVAAGKITLKLNAVLDEVLGDASGVTGARLKFKDDHAEEITVAGVFI
    AIGHKPNTDLFKGQLDMDETGYLITRGGRDGNATATSIEGVFAAGDVQDHIYRQAVTSAASGCQAALDAERFLDH

    >gi|226940415|ref|YP_002795489.1| Probable peroxiredoxin/glutaredoxin family protein [Laribacter hongkongensis HLHK9]
    MTQLINREGQRVPSVQFRVRENNDWKTVTSDELFAGKTVVVFSLPGAFTPTCSSTHLPRYNELAAVFRENGVDNILCVSV
    NDTFVMNEWAKDQESANIVMVPDGNGEFTEGMGMLVDKADLGFGKRSWRYSMLVKDGVVQKMFIEPQEPGDPFKVSDADT
    MLAYINPNAKKPDQVVVFSKDG
    CPFCAKAKELLSGKGYDYIDMALDHKVRGKVLGALSGKMTAPQVFINGKLIGGAEELE
    KYLAA

    >gi|226940416|ref|YP_002795490.1| Probable dihydrolipoamide dehydrogenase [Laribacter hongkongensis HLHK9]
    MSTPNTRYTDVAIMGTGTAGLAAYRAVKAAGLSALLIEGQAYGTTCARVGCMPSKLLIAAAEVAHEARHTAPFGIRVDGV
    QVDGREVMARVRGERDRFVGFVVQSVDGIPEEDKLWGMARFVDNTVLQVGEGEGAITVHARRVVIATGSSPTVPPGFREL
    GDRLIINDDVFSWETLPRRVAVFGPGVIGLELGQALSRLGVDIRLFGMGGSVGPLSDPQVRDYAKGVFASEFYLDVDAKV
    ESMRRDGEEVVIRYVRGEEVVEERFDYVLAATGRRPNVDNIGLENTAVALDARGVPVFDHNTLQCGSLPVFLAGDVNNIL
    PLLHEAADEGKLAGENAAGYPQLKTIRRRAPLAVVFSDPQIAIVGQRYAELDAGQIVTGEVSFEDQGRSRVMLKNRGLMH
    VYADCKTGRFLGAEWIGPRAENIAHTLAWAYQMNLTIDDMLAMPFYHPVVEEGVRTALRDAAAKLAA

    >gi|226940524|ref|YP_002795598.1| DsbC [Laribacter hongkongensis HLHK9]
    MLRLRPLAAFMLAIPLLACAAGTADNTDSVRQAFEKKFPQRQVQAVRATPVTGIYEIVLPDRQVVYADAKVKHLFVGDLI
    DVDARQSLTEARVAELSKVDWKNLPLDLAFKEVRGNGSRKLAVFSDPD
    CPFCKRLERDSLKGVANVTIYTFLYPLTSLHP
    DAMHKSAQILCSSNPQVAWSDFMLNDKPLAGDGKCAAADKLASIQQLAEKLGISGTPALVFPNGQLVSGAIPKADVEKLL
    NSK

    >gi|226940610|ref|YP_002795684.1| TrxA [Laribacter hongkongensis HLHK9]
    MSSELIVHVTDASFEEEVLKAQGPVLVDYWAEWCGPCKMIAPILDEVAREYDGKLKVAKLNIDQNEATPPKFGIRGIPTL
    MIFKDGNVVATKVGALAKSQLAAFIDSNI

    >gi|226940663|ref|YP_002795737.1| disulfide bond formation protein DsbB [Laribacter hongkongensis HLHK9]
    MVHSLFQPSLRTGFLLIALACAGAMGFALFAQYYMDLEPCPLCVFQRVAVIMTGLLALLGALLSPRSAGGRGLMAGLTGL
    ASLSGAGVAAWQVRLQNLPADQVPA
    CGPGLDYMLETMPFTDMLAKVFKGSGECAEVSWTLLGLSLPAWSLVFLIGITVFA
    AWLARMPRR

    >gi|226940784|ref|YP_002795858.1| 4-carboxymuconolactone decarboxylase [Laribacter hongkongensis HLHK9]
    MIDWKNYRQELTGRIGEIGRLSPDTVRGYQTLAGAGQKTARLDGKTRELISLAVAVTTRCDGCISFHSAAALEQGASREE
    IAEALGVAVAMNAGAAMVYSARVMDAIDAK

    >gi|226940793|ref|YP_002795867.1| rhodanese domain-containing protein [Laribacter hongkongensis HLHK9]
    MHEHCSQVLAAAAARGKELGLPYAGAVMPAEAWELVKALQATLLDVRTIAERQFVGAPPESISIEWRMWPGMEINPDFAR
    EAVAQIPTDRPVVLL
    CRSGVRSHAAAECLAGHGYTAFNILEGFEGDRDAAGQRGQLGGWRRHGLPWSQG

    >gi|226940851|ref|YP_002795925.1| ArsC1 [Laribacter hongkongensis HLHK9]
    MLSLYGIPNCGSVKKARLWLENHGIDYRFHDFKKTGIDTARLESWLDQVPVDTLVNRKGTTWRGLSDADKARAASRDGAI
    GLMQQYPSLIKRPVVETGSSLLVGFDETRYTESFGA

    >gi|226941011|ref|YP_002796085.1| Periplasmic protein thiol:disulfide oxidoreductase DsbE precursor [Laribacter hongkongensis HLHK9]
    MTPLARRRLLWALPFLVFVLLVGLFAAGLQRDPRALPSQRVGQPAPAFSLPRLDDPAQRFAPADLKGQVWLLNVWASWCS
    A
    CAQEHAAVTELARGHGVTVVGLNQQDEPDAARDWLARLGNPYRLSVMDTDGRISIDYGVYGVPETFVIDRDGIIRYRHL
    GPVTPEVNRDVLLPLIRKLQS

    >gi|226941133|ref|YP_002796207.1| Rhodanese-related sulfurtransferase [Laribacter hongkongensis HLHK9]
    MKRLLPALAALSLLLAPVTSALAAGQPLLIDVRTPAEYEAGHLPGAALAPVDRIAREIVRLAPDKDTPITLYCRSGRRSE
    AARQTLLGMGYTRVTNAGGYEELKQKSATRP

    >gi|226941135|ref|YP_002796209.1| Alkylhydroperoxidase like protein, AhpD family [Laribacter hongkongensis HLHK9]
    MAIGSYKELTQTVSGELAQLRQSQSDVMTAFGQLAQAANKPGVLDKKAKEFVALGIAVAGRCDDCIGFHVKALVQLGATR
    AEIEEVLAVAVYMGGGPSLMYSTHALKAFEEFSA

    >gi|226941330|ref|YP_002796404.1| LpdA2 [Laribacter hongkongensis HLHK9]
    MSQQFDVVVIGGGPGGYVAAIRAAQLGFNTACVDSFKNPEGQPSLGGTCLNVGCIPSKALLQSSENLHAVQHDFAAHGIS
    VNGASMDVGTMLKRKEGIIGKNAAGIAFLFKKNKVANIHGLATLKARQNEKWVIEVTDNGAVVDTLEATHVIIATGSRPR
    PLPGVAIDNRVVLDNAGALAMTGVPQRLGVIGSGVIGLEMGSVWKRLGAEVTVLEAMPAFLAAADQQIAKEAFKYLTKQT
    GLDIQLGVKIGDIKVADDSVSVAYEVGGEQKVAEFDRLIVSIGRVPNTDGLGAENVGLQVDERGFVVVDDNCHANLPNVW
    AIGDVVRGPMLAHKASEEGVAVAERIAGQKPHIDFGMIPWVIYTSPEIAWVGKTEEQLKAEGIEYKKGTSGFAANGRALG
    LGMAQGTVKVLACAKTDRILGVHIIGPFASELIAEAVVAMEFAASSEDIARIVHAHPSLSEVLHEACLAADKRALHG

    >gi|226941393|ref|YP_002796467.1| Thioredoxin domain precursor [Laribacter hongkongensis HLHK9]
    MKYLNLTHVLKITLATSLMTLSTWAAAFELKPFSTAALSTLQQQGKPVAVHFHADWCPVCINQTKSLEALKSDLSLDGMT
    VLVANYDNEKDLRRSMKVRSQSVMVIFKGRSEVARVNGQTRADDIKAAFVKAL

    >gi|226941752|ref|YP_002796826.1| Grx3 [Laribacter hongkongensis HLHK9]
    MNPVTLYTTAFCPYCQMAERLLASKGVTDLTKIRVDLDPDERQRMMERTGRRTVPQIYVGDTHVGGYDDLAALDRAGKLD
    ALLAG

    >gi|226941777|ref|YP_002796851.1| hypothetical protein LHK_02863 [Laribacter hongkongensis HLHK9]
    MAITLSERAATHVLGFLARRGKGVGLRLGVKTSGCSGMAYKLEFVDVPDPDDISFESHGVTVFTDAKSLAYIDGTELDYT
    KEGLNEGFRFNNPNVKNECGCGESFNV

    >gi|226941852|ref|YP_002796926.1| DsbA [Laribacter hongkongensis HLHK9]
    MKKWLVACLAGLMSLTAHAAIQPGTDYTPLAAPQAVANKNRVEVIEFFSYGCGHCFKLEPASEAWAKNKPADVDFRREQI
    VWDKRMDGLARLFAAIQASGQSGKLHHAAFIAVQQERLDLRDPKIVQDWVARQGVDAARFMQVYNSFSVAQAPARATQLT
    RAYRVEGTPMLVVGGKYAVTPAAPERMMQVVGELVDKVRAEQKK

    >gi|226941889|ref|YP_002796963.1| Arsenate reductase-like protein, glutaredoxin family [Laribacter hongkongensis HLHK9]
    MPAESGVAPLPGIGQNESLMILPGLPMTAVTVYHNPRCSKSREALRLLEEAGVTPVVVDYQKTPLTEAGLVQVLRRLGCE
    ARDIMRRDEPEYRELFLDDVTLSEAHLLGAIVEHPRLLQRPIVVAGDRAVIARPPSLALELVGLAARPEPA

    >gi|226941948|ref|YP_002797022.1| Copper-translocating P-type ATPase [Laribacter hongkongensis HLHK9]
    MEQKLTLPITGMTCASCANRIETRLNRLEGVTAVVNFANETATVTLPEGMPAQTVIDTVRATGYDVDPERLTLDLEGMTC
    ASCATRIETVLNRLPGVSAAVNFATETAQVSYLPGSHTPDELIAAVARAGYGATVQAGDDRAARQAEQERVWRHELGHFV
    IAVVLTLPLLAGMFGMLTGGPHELLPRGWQLVLATPVQFWIGWRFYKGAWHALRGGGANMDVLVALGTSMAYGFSALVTL
    LGATHMHVYFEASASVITLILLGKLLEARAKRRTSSAIESLLSMQPKTARVERNGKLAEVPIASLQPDDVVVVRYGEAVP
    VDGVVLEGRAAVDESMLSGESLPVEKAVDASVYAGTRNVEGALKVRVTGVGNQTQLAEIVRLVSEAQGSKAPIQRLADRI
    SGVFVPVVVGLAVLTFFGSWWWAGSATVGLIHAVAVLVIACPCALGLATPTAIMVGVGRGAQAGLLFRNASALERAEKID
    TLVVDKTGTLTEGRPVLTEVQALAGVPRETLLAWAAGLEQGSEHPLARAVLEGANKEGVTAAAVTDFAVEPGHGVSARLP
    DGTLLRLGTPAWVGGLTDEQRGGLARLASRGQTVVVLAQEDGAVGLLAIADQLRASSPAAVRRLQDMGVKVMMLTGDNPA
    TAASVASHVGLADYRAEVKPGDKARIVQELVAAGRKVAMAGDGVNDAPALAAADVGFAMGAGSDVAIETAGVTLMKSDLM
    AVADAIDLSRHTMKKIRQNLFFAFVYNVLGIPLAAVGLLNPVIAGAAMAASSVSVVSNSLLLRRWRAMR

    >gi|226942070|ref|YP_002797144.1| UBA/ThiF-type NAD/FAD binding fold protein [Laribacter hongkongensis HLHK9]
    MTAPDLDRRFGGMHRLYGDAEAGRIRQSHVCVVGIGGVGSWAVEALARAGVGELTLIDLDNVCESNVNRQIHALDGTFGL
    PKVEAMAERVRLVNPACQVHTVEDFISADNVATLLAPPVGLVIDAIDDLRAKAAMAAWCRRQSLPLLVSGAAGGRIDPTR
    IQVADLARVTGDPVCARLRYELRKKYGFSRDPKARFGIECVFSDEPVRKPQAGAA
    CESGAAPQGLACAGYGSAMTVTASM
    GLVLVSRALLRLSAG

    >gi|226942088|ref|YP_002797162.1| Probable thioredoxin [Laribacter hongkongensis HLHK9]
    MKKILLAVAALAVVAVIAWTVTDRNPAPAVQYQALDGRTTSTEALKGRVVLVNFWATSCPGCIKEMPALKDTHTRYAPKG
    YETVAVAMSYDPPDYVKTYVEQNRLPFFVALDSQGQLAQAFGGVQLTPTSILVGKDGQIIKRYLGEPDFAELHRLIEQAL
    AA

    >gi|226942097|ref|YP_002797171.1| DipZ [Laribacter hongkongensis HLHK9]
    MKRFQANPETLFPPTMKRFLCACLLFWTALCAHALTAEDLLPPERAFALSASRSGDVVRLNWSIADGYYLYRDRVSIRTE
    PPADIRPELPPGQLKHDPFFGETPVWRQAVEGKVRLPAGTPSPIQLVITQQGCADAGVCYPPQTIRLSLAADGRTVSAGS
    PAAGFLSAPPAAASPAGQPANDGSGLGSLGWGALTASFFVAGLGMALTACLYPMLPIVSAIIAGHGTAAHGWRGLLLALA
    YVEGLALTYTVVGVAAGLTGSWLTVWLQRPEVAVLAAVMLVLLALAMFDIISVQLPAGFQARMASSSNRLTGGRLASVFG
    MGALSALIIGPCVAPPLAVALGYIGASGDALTGGVALFAMAQGLGAPLLLVGAAGGQLLPKAGPWMKAVKAVFGVGMLLL
    AVYLLAPYLPPALPLAAYGIILIVSAVFAGAFDSMPAGSHPGRRLLKSLGLLAALLGAVQLVGSLAGADDPRYPLAPLTA
    RADSPATAAPAFTSVSSLAEWESFLAANRGRPVLLDFYADW
    CASCKEMERETFHDPAVAQAMRGMALAQADVTANTPAHQ
    ALLKHFGLFGPPGIILFSAQGQESGRVIGFMPPTAFLQEISAVTPSAPQ

    >gi|226941947|ref|YP_002797021.1| Heavy-metal-associated domain protein [Laribacter hongkongensis HLHK9]
    MQTLELKIDGMTCGGCVNSVSRVLKAQAGVDDAQVELGRAVIRFDPAVTDAGKLRAAVEDAGYAVI

    >gi|226939114|ref|YP_002794185.1| electron transport protein SCO1/SenC [Laribacter hongkongensis HLHK9]
    MTHLLRALTVALFGLMLAACSPQPGAAGPSFAATDVTGAGYAQALTLDGTDGRPRSLADFRGKAVVVFFGYTHCPDVCPT
    TLSELSQAMRDMGPLADQVQVLFVSVDPQRDTPELLHSYVTGFDRRFAALTGSAEAIARTARAYKVVYQQVAGPVPADYT
    IDHSAGAYLYDPAGSLRVYVPYGSGAAVFRHDLTVLLGQTPPPLTATKAQ

    >gi|226939545|ref|YP_002794618.1| IspH [Laribacter hongkongensis HLHK9]
    MMRDILLANPRGFCAGVDRAIAIVERALEKFGAPIYVRHEVVHNTFVVEGLKRKGAVFIEDLAEVPAGSTLVYSAHGVPL
    SVRLEAESRGLTVFDAT
    CPLVTKVHVEVRKMREAGLEIVMIGHAGHPEVEGTMGQAPDGMYLVETAADVAKLQVRKPEQL
    AYVSQTTLSVDETRGIIAALEARFPAIHGPKKDDICYATQNRQDAVKQLAGECDIVIVVGSPTSSNSNRLREVALQRGVT
    AYMVDNAAELQPDWFAGKARVGLTAGASAPEVLVQSVLDTIRSYGLDTVTELPGVEETITFSLPGGLRDPA