Lactococcus lactis KF147 uid42831

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|281490533|ref|YP_003352513.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Lactococcus lactis subsp. lactis KF147]
    MVVGAQATEVDLVVIGSGPGGYVAAIRAAELGKKVTIIEKDNVGGVCLNIGCIPSKALINIGHHYQESLEEEKGENPFGL
    SVGNVKLNWESAQKWKQDKVVNQLTGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIP
    SFPFGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDKEMSDIIANRVKSAGSEIF
    TSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRPNTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDV
    VPGPMLAHKASFQAKVAAAAIAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDTT
    GFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAIMDTAELADGLPIHV

    >gi|281490541|ref|YP_003352521.1| osmotically inducible protein C [Lactococcus lactis subsp. lactis KF147]
    MKNISTASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQAHITTPEELLGAAHAACFSMAFSMVLGQKGLVATSI
    DTTADVTFEATADGPAITKIKLTNRSVVPELSEADFQEIAKVVKES
    CPVSKALSGVDIELEATLG

    >gi|281490678|ref|YP_003352658.1| peptide methionine sulfoxide reductase [Lactococcus lactis subsp. lactis KF147]
    MEKEELKKKLSPLAYRVTQENGTEAPFANEFDDFFEKGLYVDVVSGEALFTSLDKYQSGCGWPAFTQPIDKGVVKEKRDK
    SLFMERTEVRSSNADSHLGHVFTDGPLDKGGLRY
    CINSAALRFVPFDQLEAEGYGEYVKYFS

    >gi|281490746|ref|YP_003352726.1| NAD(FAD)-utilizing dehydrogenase [Lactococcus lactis subsp. lactis KF147]
    MTKSAKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKKLLMTGGGRCNVTNARSVDEILTNVPGNGRFLHSAF
    SQFSNLDIIEFFESNGVKLKEEDHGRMFPITDKSKTIVDALFNKILSLHVSYFPSQAVDKLLIENGAVIGLETDSESFLS
    PTIILSTGGRAYPSTGSTGDGYRLARSAGHSISQLYATESALISDEPFILDKSLQGISLREIKLSVLNSKGKAIISHQHD
    LLFTHFGISGPAALRCSSFINQLLAKGEKMVTVSLDQFSEKKLGSLKNELTSLSKTDKSIKNAFSGLTQERMLLFILEKA
    GIDPSLSAKTLSEQQIDKIASLFKNWQITISKTLPIEKSFVTGGGVSLKEINPKSMESKQTQGLFMTGELLDINGYTGGY
    NITCAFVTGFVAGKHAAQIASYFQQ

    >gi|281490845|ref|YP_003352825.1| thioredoxin peroxidase [Lactococcus lactis subsp. lactis KF147]
    MTMNITSHGEKIATLNPTISGDAPDFELTDLKGNKIKLSKLEKPVLISVFPDINTRVCSLQTKYFNLEAAKHSEIDFLSI
    SNNTADEQKNWCAAEGVDMTILADDGTFGKAYGLILNGGPLEGRLARSVFVVKNGQIVYSEVLSELSDEPNYEKALAATK


    >gi|281490884|ref|YP_003352864.1| peroxiredoxin [Lactococcus lactis subsp. lactis KF147]
    MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWSVLCFYPADFSFVCPTELEDLEETYPTLKSLGVEVYSASTDTHFVHA
    AWHEHSDAISKITYPMLADPSQKISRAFDVLDEEAGLAQRGTFIIDPDGVIQALEITADGIGRDASQLVDKIKAAQYVRN
    HPGEVCPAKWKEDGASLHVGIDLVGKI

    >gi|281490885|ref|YP_003352865.1| peroxiredoxin reductase [Lactococcus lactis subsp. lactis KF147]
    MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIVEFTDELASLSEMISKETAKLNRKTAFSIEREGVSGVLFSGL
    PLGHELNSLVLALVQVSGRPPRIEQELVERIQAIQNPLHFETYVSLT
    CHNCPDVVQALNTMSILNPNISHTMIEGGMFQE
    EVEAKGIMAVPTVFKNGEEFHNGRASLEELLEKITGPESSKAFSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGLIAER
    FGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLENGALLKSKSVIISTGARWRD
    LGIPGEQEFKTKGVAY
    CPHCDGPLFAGKDVAVIGGGNSGIEAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTV
    LTNVETKEILGDDKVRGLNYQVRGSKEIVHLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGVFAAGDC
    TDSVYKQIIISMGTGATASLGAFDYLIRN

    >gi|281490925|ref|YP_003352905.1| osmotically inducible protein C [Lactococcus lactis subsp. lactis KF147]
    MVKHLFNSHIDWLGGRNSIGDLQAGALNEKISIPKTMDGPGVGTNPDEMLLGAASTCYSITLAAMLERNDILLEHLKVDA
    KGIVDVTKGTFTYEKITYHVAMKLTKESDEVKAIKLAKRAESS
    CMISRAIQGNIELETIIRIEK

    >gi|281490931|ref|YP_003352911.1| thioredoxin [Lactococcus lactis subsp. lactis KF147]
    MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIEVENPDFKFVEVDRDEYMDLAIEWGIMGIPSFVVIEDG
    KEKARLVNKLRKTKEEVNTFLASAK

    >gi|281490933|ref|YP_003352913.1| NADH oxidase [Lactococcus lactis subsp. lactis KF147]
    MKIVVIGTNHAGIATANTLIDQYPGHEIVMIDRNSNMSYLGCGTAIWVGRQIEKPDELFYAKAEDFEKKGVKILTETEVS
    EIDFTNKMIYAKSKTGEKITESYDKLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDEEFAKNDVKRIAVIGAGYIG
    TEIAEAAKRRGKEVLLFDAESTSLASYYDEEFAKGMDENLAQHGIELHFGELAQEFKANEEGHVSQIVTNKSTYDVDLVI
    NCIGFTANSALAGEHLETFKNGAIKVNKHQQSSDPDVYAVGDVATIYSNALQDFTYIALASNAVRSGIVAGHNIGGKSIE
    SVGVQGSNGISIFGYNMTSTGLSVKAAKKIGLEVSFSDFEDKQKAWFLHENNDSVKIRIVYETKSRRIIGAQLASKSEII
    AGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK

    >gi|281490997|ref|YP_003352977.1| O6-methylguanine-DNA methyltransferase [Lactococcus lactis subsp. lactis KF147]
    MLTKKKYQSPLGEITLLSDETYLLGVWFKEQKYFAANYDLNQAKEDKSLPIINAIEWLDAYFKGENPDFKKIKLKPEVTE
    FRKKVLKILSDVPYGSLITYKEISNLLQVNEEKKRNMSQAVGGAVGHNPLSIIIP
    CHRVVGTDGSLTGYAGGLEKKKALL
    TLEQAHLKK

    >gi|281491012|ref|YP_003352992.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MGNRTVIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRHILTKTENGTEDIISTRSKVFQKLAVDVDNLT
    INELLDLVTEFPNLLRRPIITDSKHLQIGFNEDEIRAFLPREYRRAEMLSTID

    >gi|281491058|ref|YP_003353038.1| organic hydroperoxide resistance family protein [Lactococcus lactis subsp. lactis KF147]
    MKKIFSTKMINTGGRNGEVHSPDKSFNLDIVAPGRKVEGATNPEQLFAAGYSACFNSALDYIKKSKNIEGESTIEVTVSL
    YNLSQNEIPDVVLGVDITGHIEGVGTEETEELLKLTHKT
    CPYSRATQGNIEVTIKAI

    >gi|281491137|ref|YP_003353117.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MITIYTAPSCTSCKKAKTWLSYHHIPFNERNLIADPLSTTEISQILQKCDDGVEGLISSRNRFVKTLGVDFEDISLSQAI
    KIISENPQIMRRPIIMDEKRLHVGYNEEEIRAFLPRTVRVLENGGARLRSAI

    >gi|281491280|ref|YP_003353260.1| rhodanese-like domain family protein [Lactococcus lactis subsp. lactis KF147]
    MEIINLTYIPLGVYNYYKSNKQEVKMQTIDISELELLTESENPVIVDVREDFEYNSGHVPNAKNIPLSQLEERYAEITDG
    TYLI
    CQSGARSARACQYLSTKGIDTINISGGTIAWNGPLEFTDRL

    >gi|281491281|ref|YP_003353261.1| rhodanese-like domain family protein [Lactococcus lactis subsp. lactis KF147]
    MFEFFKKIKSISPAEVSTELKKGTQLIDVREAHEFQNGHIKGARNIPLSKLGEHVLAKNKKYLLICQSGMRSKKAYKILN
    KANYDVTNVNGGMRAWRGKIKK

    >gi|281491282|ref|YP_003353262.1| NADH dehydrogenase [Lactococcus lactis subsp. lactis KF147]
    MIEKILIVGGVAGGMSAATRLRRLNENAEIIVFERGPYVSFANCGLPYYVGGEIAEREKLIVQSAKALKNRFNLEVRENS
    EVIAIDSEGKKVTVVSNGESYVESYDKLILSPGAKPLIPQIKGLNQATNVFSLRNIPDVDKIMTYLKAKAPKSATIIGAG
    FIGLEMAENLAKRELSVTIVEKAPHVLPTIDREMAAFVNEELIKNNLSVMTNRGAVEFKNDEILLDNGESLQSDLTILSV
    GIQPETSLAKSAGIKLGLRNAILVDEHYETSVKDIYAVGDAIVVKNQLGQDALISLASPANRQGRQVADIISGLPVKNRG
    SLGTAIVRVFDLQVASTGLSEFQLRGLKINHKIVHVTANNHAGYYPDATSIVLKLIFEPESGQIFGAQAIGKEGVDKRID
    ILSTAIKAKLTVFDLPELELTYAPPFGSAKDPVNMAGYAATNLLLGQSENIQWHELAAELAKGKVLLDVRNPNELAKGKF
    KNSQNIPLDDLRERLNELDKKTEYIVS
    CQSGLRSYNAERILKQEGYKVKNLDGAFGLYSKVTKVLLD

    >gi|281491284|ref|YP_003353264.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MYDFYWYPKCSTCRKAKAKLDELGIDYQAIDLKETPPSQKNFEKWFKEADFPIKKFFNTSGLVYRDLNLKDKLATLSEKE
    MAELLSSNGMLIKRPLLVKNGQVQQIGFKESSYEKI

    >gi|281491321|ref|YP_003353301.1| copper chaperone CopZ [Lactococcus lactis subsp. lactis KF147]
    MKETLKIEGMTCDHCVMHVTNALEAIDGVEKAKVSLKKNEALVKFSAPADMDKMAVAVAEAGYKVI

    >gi|281491322|ref|YP_003353302.1| copper-translocating P-type ATPase [Lactococcus lactis subsp. lactis KF147]
    MRSQSFVITGMTCANCVNTVSKTLNQSDKIMEATVNLATEKAKIVADDNISDQEIINLVEKAGYGAIVNDKAHQEKIARQ
    AAKKARNLALSFWIALILTLPLVVAMFADIFGVHANWVMFLHEPIVQLILATPVQFVIGWRFYVGAYHALRNKSANMDVL
    VALGTSVAYFSSLILAVFMSQANALNFESSMVIITLVVMGKLLEHNAKEKTTQAITGLMSSRATFVHTESTDLAIEEVQM
    GQVIRILPGEKVPLDAMILSGKASFDESILTGEALPVVKMDDEVIFEGTINLDGEVKAVVVHDLNDSTISRMVEMMSEAQ
    GSKPNIQKLADKISGIFVPVVLVIALITFIATWAVSGILLTAIMHSVAVLVIACPCALGLATPTAIISGTGLAAKNGLLI
    KNANALELAGLVKTVFFDKTGTITTGEFELTDFKLLTESEKVTDSFNSSEEKMVSDEFRLLASLEAHSNHPLAKSLKFQG
    DLYELTDLSELAGRGLSAKINGQEYFAGNDKLMTDLNLSVPETDDTVIYLANKEKLLAMAVFSSSLKDDALKTIQTLQKR
    GLKTVMLTGDNQNSAAKIQKLVHLDEVKSGLRPEEKAEIVQNSPNSMMVGDGINDAIALASATVGLAMATGSDIAMEAGD
    VTVTSGQLHKISTFFEVAKKTISKIKQNYFWAFVYNVIGIPLAAFGLLNPMLAAAAMSLSSVSVILNSLLLTKTKIKNVE


    >gi|281491334|ref|YP_003353314.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MIKIYTVASCSSCKKAKEWLEKQNLAYQEINLVTSRICKEDILEILALTEEGTGDIISRRSQAYQRLNIDFETIKLNDLI
    QIIEENPTLLRRPLIVDHKRLQVGYNDDEIRKFLPRKKREIQIKVATEASYNLDIEEQFHEG

    >gi|281491335|ref|YP_003353315.1| glutathione reductase [Lactococcus lactis subsp. lactis KF147]
    MFDYIIIGAGPGGLGLAYRLKTKDNKIGIIENDKWGGTCPNYGCDPTKMMMAVVEAKSRVEQLKGQGISGELNIDWKGLK
    SRKLNITDPYEKSTFTGLKNAGIETIYGSAAFNDQGELEVEGKTYQAKTYIIATGSRPRLLDIAGKEFLKTSNDFLALEV
    FPAQISFLGSGPISLELAQIAKAAGSDVTIISRKKEKAAHFDEEMGQEFINYLKAQGIKFIEDISVNKVEKIADGFLLTD
    GTDFEHKTDLVIAGVGRQPNSDKLNLEKVGVETDAKGIKVNEYLQTSNSKIYAMGDVLSKNQPHLTPVSSFEGAYLGENL
    VKDEPQKIAYPAIPTIIFGTAKLAEVGHLAGEGIHTKTLDLSSWYTYKRINDPLAKLKVALNEKREIVGASTVSSVADEV
    INLINILIQQKMTLADVEKMIFTYPTVASDLEYFY

    >gi|281491443|ref|YP_003353423.1| thioredoxin-disulfide reductase [Lactococcus lactis subsp. lactis KF147]
    MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMGPELSMKMAEPLEGLGVENAY
    GFVTSIEDHGDYKKIITEDDEFVTKSIIIATGANHRKLEIPGEEEYGARGVSY
    CAVCDGAFFRNQEILVIGGGDSAVEEA
    LYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKVQSVVYKNVKTGEVTEKAFGGIFIYVGL
    DPVAEFAGNLGITDEAGWIITDDHMRTSLPGIFAVGDVRQKDFRQITTAIGDGAQAAQEAYKFVAELD

    >gi|281491480|ref|YP_003353460.1| ribonucleoside reductase, glutaredoxin subunit [Lactococcus lactis subsp. lactis KF147]
    MVTVYSKNNCMQCKMVKKWLSEHEIAFDEINIDEQPEFVEKVIEMGFRAAPVITKDDFAFSGFRPSELAKLA

    >gi|281491562|ref|YP_003353542.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MIKIYLSGSCSSCRKAKKWLRKHHIEFEEINLSKDVMEKDDLIKILSLTENGFEDIIATRGKTYASLNYNFDELGLEKAF
    KLIQENPRLLKRPLIFDEDCLLIGFNEDGIRAFIPPEVRRIELRERLILV

    >gi|281491720|ref|YP_003353700.1| hypothetical protein LLKF_1259 [Lactococcus lactis subsp. lactis KF147]
    MTQDYRVLLYYQYVPIEDGETFAQKHLADCKELGLKGRILVADEGINGTVSGTIEQTNAYMELMKNDPRFSSTIFKIDEA
    EQNAFKKMHVRYRPELVNLSLEDDVNPLELTGAYLDPKEFREAMLDENTVVIDARNDYEFDLGHFRGAIRPEIRSFRELP
    QWIRDNKEQFMEKRVLTY
    CTGGIRCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKE
    HVIVGRDWFDGSPCERYINCGNPECNRQMLASEENEAKYLGACSHECRVHPNNRYIKAHQLSNQEVQERLALLEKDLAS

    >gi|281491867|ref|YP_003353847.1| arsenate reductase family protein [Lactococcus lactis subsp. lactis KF147]
    MIKLFSSTNCSSSKKMKQWLITNKLEFEEISILENTLLKKDILRILSLTETGVEEIISKRSSAYKKLSKIIDFDALTLNS
    LVELIVQNQKLLRRPLVVDEHRLQVGYNEDDIRKFLPRKFRQLGLMTAIENVRIWDQAK

    >gi|281491907|ref|YP_003353887.1| glutathione peroxidase [Lactococcus lactis subsp. lactis KF147]
    MNFYDFSAVKMNGETVSMSDFKGKVVIVVNTASKCGFTPQFEGLEKLYENYKDQGLEILCFPCNQFANQDAGENSEINEF
    CQLNYGVTFPMFQKIKVNGKEAHPLYQFLKKEAKGALSGTIKWNFTKFLIDREGNVIERFAPKTEPKEMEEEIQKLL

    >gi|281492114|ref|YP_003354094.1| peptide methionine sulfoxide reductase MsrA [Lactococcus lactis subsp. lactis KF147]
    MSTERAIFAGGCFWCMVETFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLDIYWSLID
    PTDADGQIYDRGANYRPVIFVESEEQRIAAQKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDPKRYQAMHK
    ARERYLALQRFKGKFKFLRKNTR

    >gi|281492225|ref|YP_003354205.1| thioredoxin [Lactococcus lactis subsp. lactis KF147]
    MEYNITDATFDEETKEGLVLIDFWATWCGPCRMQAPILEQLSEELDESELKICKMDVDENPATAQGFGIMSIPTLMFKKD
    GEEVKRIVGVQTKAQLKAVIAELS

    >gi|281492611|ref|YP_003354591.1| peptide methionine sulfoxide reductase [Lactococcus lactis subsp. lactis KF147]
    MATERAIFAGGCFWCMVQPFEEREGILSVISGYTGGNVENPTYEQVKKHLTGHTEAVEIIFDNSKITYQSLVELYWTLTD
    PTDAFGQFEDRGDNYRPVIFVENEEQEKIAKESKAQLQASGNFDSPIVTSIEAVQKFWPAEDYHQGFYKKNPEDYAQSSK
    IRHDFLEKQWEK

    >gi|281492709|ref|YP_003354689.1| pyridine nucleotide-disulphide oxidoreductase [Lactococcus lactis subsp. lactis KF147]
    METRHFKNIIIGFGKAGRALAKTLSQHGEEALIIERDQAMYGGTCPNVGCAPSKTLIVAGQKNMNFSEAMATKYKVREIL
    HNGAYHGAADEPLVYVMDGIARFINQETLEVVNGDKISKVIGKRIFINTGATPVISEISGIQESKNVITSEGAMELSELP
    KKLVIIGAGYIGLEFAGMFNKFGSKVTILEPHSTFLPKEDDDISREIFKDLKASGVEIHLGVKVEKITDSEVLAGGQTYS
    ADKILVATGRRPNITDLNLEKAGVELSESGYIKVDDDLKTSTENIWALGDVRGGGQFYYLSTDDFRIVNNQLFGDHSRKL
    SDRTLVPYSVFISPTLSRIGLDEKQAKKAGVNYRLFKMAAAPIVKSKVVQDTRGILKALVDPKTDEILGATLYHEDSHEV
    INLVSLAMKMHTPYQILRDQIFTHPTMGEGLNDLFQNEVK

    >gi|281492721|ref|YP_003354701.1| Heavy metal-chaperone/transport protein [Lactococcus lactis subsp. lactis KF147]
    MSKIVMKLDELSCPSCMAKIEGALNTTNGVEMAKVLFNASKVKAEFDDNQVTATDLVSKVEGLGYVVQKSKVTEI

    >gi|281427996|ref|YP_003354950.1| copper chaperone [Lactococcus lactis subsp. lactis KF147]
    MSKVIMKLNELSCPSCMAKIEGAMTTTKGVANAKVLFNASKVKAEFDENVVSADELISKVEKLGYPVLSSKVTVV