Lactococcus lactis Il1403 uid57671

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15672041|ref|NP_266215.1| dihydrolipoamide dehydrogenase [Lactococcus lactis subsp. lactis Il1403]
    MVVGAQATEVDLVVIGSGPGGYVAAIRAAELGKKVTIIEKDNVGGVCLNIGCIPSKALINIGHHYQESLEEEKGENPFGL
    SVGNVKLNWESAQKWKQDKVVNQLTGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIP
    SFPFGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDKEMSDIIANRVKSAGSEIF
    TSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRPNTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDV
    VPGPMLAHKASFQAKVAAAAIAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDTT
    GFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAIMDTAELADGLPIHV

    >gi|15672049|ref|NP_266223.1| osmotically inducible protein [Lactococcus lactis subsp. lactis Il1403]
    MKNISTASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQAHITTPEELLGAAHAACFSMAFSMVLGQKGLVATSI
    DTTADVTFEATADGPAITKIKLTNRSVVPGLSEADFQEIAKVVKES
    CPVSKALSGVDIELEATLG

    >gi|15672171|ref|NP_266345.1| methionine sulfoxide reductase B [Lactococcus lactis subsp. lactis Il1403]
    MEKEKLKKKLSLLAYRVTQENGTEAPFANEFDDFFEQGLYVDVVSGEALFTSLDKYQSGCGWPAFTQPIDKGVVKEKRDK
    SLFMERTEVRSSNADSHLGHVFTDGPLDKGDLRY
    CINSAALRFVPFDQLEAEGYGEYVKYFS

    >gi|15672240|ref|NP_266414.1| hypothetical protein L56208 [Lactococcus lactis subsp. lactis Il1403]
    MTKSAKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKKLLMTGGGRCNVTNARSVDEILTNVPGNGRFLHSAF
    SQFSNLDIIEFFESNGVKLKEEDHGRMFPITDKSKTIVDALFNKILSLHVSYFPSQAVDKLLIENGAVIGLETDSESFLS
    PTIILSTGGRAYPSTGSTGDGYRLARSAGHSISQLYATESALISDEPFILDKSLQGISLREIKLSVLNSKGKAIISHQHD
    LLFTHFGISGPAAMRCSSFINQLLAKGEKMVTVSLDQFPEKKLGSLKNELTSLSKTDKSIKNAFSGLTQERMLLFILEKA
    GIDPSLSAKTLSEQQIDKIASLFKNWQITISKTLPIEKSFVTGGGVSLKEINPKSMESKQTQGLFMTGELLDINGYTGGY
    NITCAFVTGFVAGKHAAQIASYF

    >gi|15672286|ref|NP_266460.1| thiol peroxidase [Lactococcus lactis subsp. lactis Il1403]
    MPMNITSHGEKIATLNPPISGDAPDFELTDLKGNKIKLSKLEKPVLISVFPDINTRVCSLQTKHFNLEAAKHSEIDFLSI
    SNNTADEQKNWCATEGVDMTILADDGTFGKAYGLILNGGPLEGRLARSVFVVKNGQIVYSEVLSELSDEPNYEKALAATK


    >gi|15672319|ref|NP_266493.1| alkyl hydroperoxide reductase [Lactococcus lactis subsp. lactis Il1403]
    MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWSVLCFYPADFSFVCPTELEDLEETYPTLKSLGVEVYSASTDTHFVHA
    AWHEHSDAISKITYPMLADPSQKISRAFDVLDEEAGLAQRGTFIIDPDGVIQALEITADGIGRDASQLVDKIKAAQYVRN
    HPGEVCPAKWKEDGASLHVGIDLVGKI

    >gi|15672320|ref|NP_266494.1| alkyl hydroperoxide reductase [Lactococcus lactis subsp. lactis Il1403]
    MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIVEFTDELASLSEMISKETAKLNRKTAFSIEREGVSGVLFSGL
    PLGHELNSLVLALVQVSGRPPRIEQELVERIQAIQNPLHFETYVSLT
    CHNCPDVVQALNTMSILNPNISHTMIEGGMFQE
    EVEAKGIMAVPTVFKNGEEFHNGRASLEELLEKITGPESSEAFFDKDPYDVLVVGGGPAGASAAIYAARKGIRTGLIAER
    FGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLENGALLKSKSVIISTGARWRD
    LGIPGEQEFKTKGVAY
    CPHCDGPLFAGKDVAVIGGGNSGIEAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTV
    LTNVETKEILGDDKVRGLNYQVRGSKETVHLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGVFAAGDC
    TDSVYKQIIISMGTGATASLGAFDYLIRN

    >gi|15672364|ref|NP_266538.1| hypothetical protein L186839 [Lactococcus lactis subsp. lactis Il1403]
    MVKHLFNSHIDWVGGRNSIGDLQAGALNEKISIPKTMDGPGVGTNPDEMLLGAASTCYSITLAAMLERNDILLEHLKVDA
    KGIVDVTKGTFTYEKITYHVAMKLTKESDEVKAIKLAKRAESS
    CMISRAIQGNIELETIIRIEK

    >gi|15672371|ref|NP_266545.1| thioredoxin H-type [Lactococcus lactis subsp. lactis Il1403]
    MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIEVENPDFKFVEVDRDEYMDLAIEWGIMGIPSFVVIEDG
    KEKARLVNKLRKTKEEVNTFLASAK

    >gi|15672373|ref|NP_266547.1| NADH oxidase [Lactococcus lactis subsp. lactis Il1403]
    MKIVVIGTNHAGIATANTLIDRYPGHEIVMIDRNSNMSYLGCGTAIWVGRQIEKPDELFYAKAEDFEKKGVKILTETEVS
    EIDFTNKMIYAKSKTGEKITESYDKLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDEEFAKNDVKRIAVIGAGYIG
    TEIAEAAKRRGKEVLLFDAESTSLASYYDEEFAKGMDENLAQHGIELHFGELAQEFKANEKGHVSQIVTNKSTYDVDLVI
    NCIGFTANSALAGEHLETFKNGAIKVDKHQQSSDPDVSAVGDVATIYSNALQDFTYIALASNAVRSGIVAGHNIGGKSIE
    SVGVQGSNGISIFGYNMTSTGLSVKAAKKIGLEVSFSDFEDKQKAWFLHENNDSVKIRIVYETKNRRIIGAQLASKSEII
    AGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK

    >gi|15672513|ref|NP_266687.1| 6-O-methylguanine-DNA methyltransferase [Lactococcus lactis subsp. lactis Il1403]
    MLTKKNYQSPLGEITLLSDETYLLGVWFKEQKYFAANYDLNQAKEDKSLPIINAIDWLDAYFKGENPDLKKIKLKPEVTE
    FRKKVLKILSDVPYGSLITYKEISNLLQVNEEKKRNMSQAVGGAVGHNPLSIIIP
    CHRVVGTDGSMTGYAGGLEKKKALL
    TLEQAHLKK

    >gi|15672528|ref|NP_266702.1| hypothetical protein L132585 [Lactococcus lactis subsp. lactis Il1403]
    MIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRHILTKTENGTEDIISTRSKVFQKLAVDVDNLTINELL
    DLVTEFPNLLRRPIITDSKHLQIGFNEDEIRAFLPREYRRAEMLSTID

    >gi|15672574|ref|NP_266748.1| hypothetical protein L183902 [Lactococcus lactis subsp. lactis Il1403]
    MKKIFSTKMINIGGRNGEVHSPDKSFNLDIVAPGRKVEGATNPEQLFAAGYSACFNSALDYIKKSKNIEGESTIEVTVSL
    YNLSQNEIPDVVLGVDITGHIEGVGTEETEELLKLTHKT
    CPYSRATQGNIEVTIKAI

    >gi|15672657|ref|NP_266831.1| transcriptional regulator Spx [Lactococcus lactis subsp. lactis Il1403]
    MITIYTAPSCTSCKKAKTWLSYHHIPFNERNLIADPLSTTEISQILQKCDDGVEGLISSRNRFVKTLGVDFEDISLSQAI
    KIISENPQIMRRPIIMDEKRLHVGYNEEEIRAFLPRTVRVLENGGARLRSAI

    >gi|15672766|ref|NP_266940.1| hypothetical protein L193291 [Lactococcus lactis subsp. lactis Il1403]
    MEIINLTYIPLGVYNYYKSNNQEVKMQTIDISELELLTESENPVIVDVREDFEYNSGHVPNAKNIPLSQLEERYAEITDG
    TYLI
    CQSGARSARACQYLSTKGIDTINISGGTIAWNGPLEFTDRL

    >gi|15672767|ref|NP_266941.1| hypothetical protein L193718 [Lactococcus lactis subsp. lactis Il1403]
    MFELFKKIKSISPAEVSTELKKGTQLIDVREAHEFQNGHIKGARNIPLSKLGEHVLAKNKKYLLICQSGMRSKKAYKILN
    RANYDVTNVNGGMRAWRGKIKK

    >gi|15672768|ref|NP_266942.1| NADH oxidase [Lactococcus lactis subsp. lactis Il1403]
    MTEKILIVGGVAGGMSAATRLRRLNENAEIIVFEKGPYVSFANCGLPYYVGGEIAEREKLIVQSAKALKNRFNLEVRENS
    EVIAIDSEGKKVTVVSNGESYVESYDKLILSPGAKPLIPQIKGLNQATNVFSLRNIPDVDKIMTYLKAKAPKSATIIGAG
    FIGLEMAENLAKRGLSVTIVEKAPHVLPTIDREMAAFVNEELIKNNLSVMTNRGAVEFKNDEILLDNGESLQSDLTILSV
    GIQPETSLAKSAGIKLGLRNAILVDEHYETSVKDIYAVGDAIVVKNQLGQDALISLASPANRQGRQVADIISGLPIKNRG
    SLGTAIVRVFDLQVASTGLSEFQLRGLKINHKIVHVTANNHAGYYPDVTSIVLKLIFEPESGQIFGAQAIGKEGVDKRID
    ILSTAIKAKLTVFDLPELELTYAPPFDSAKDPVNMAGYAAINLLLGQSENIQWHELAAELAKGKVLLDVRNPNELAKGKF
    KNSQNIPLDDLRERLNELDKKNEYIVS
    CQSGLRSYNAERILKQEGYKVKNLDGAFGLYSKVTKELLD

    >gi|15672770|ref|NP_266944.1| hypothetical protein L196017 [Lactococcus lactis subsp. lactis Il1403]
    MYDFYWYPKCSTCRKAKAKLDELGIDYQAIDLKETPPSQKNFEKWFKEADFPIKKFFNTSGLVYRDLNLKDKLATLSEKE
    MAELLSSNGMLIKRPLLVKNGQVQQIGFKESSYEKI

    >gi|15672815|ref|NP_266989.1| mercuric reductase [Lactococcus lactis subsp. lactis Il1403]
    MKETLKIEGMTCDHCVMHVTNALEAIDGVEKAKVSLKKNEALVKFSAPADMDKMAVAVAEAGYKVI

    >gi|15672816|ref|NP_266990.1| copper/potassium-transporting ATPase [Lactococcus lactis subsp. lactis Il1403]
    MRSQSFVITGMTCANCVNTVSKTLNQSDKIMEATVNLATEKAKIVADDNISDQEIINLVEKAGYGAIVNDKAHQEKIARQ
    AAKKARNLALSFWIALILTLPLVVAMFADIFGVHANWVMFLHEPIVQLILATPVQFVIGWRFYVGAYHALRNKSANMDVL
    VALGTSVAYFSSLILAVFMSQANALNFESSMVIITLVVMGKLLEHNAKEKTTQAITGLMSSRANFVHTESTDLAIEEVQM
    GQVIRILPGEKVPLDAMILSGKASFDESILTGEALPVVKMDDEVIFEGTINLDGEVKAVVVHDLNDSTISRMVKMMSEAQ
    GSKPNIQKLADKISGIFVPVVLVIALITFIATWAVSGILLTAIMHSVAVLVIACPCALGLATPTAIISGTGLAAKNGLLI
    KNANALELAGLVKTVFFDKTGTITTGEFELTDFKLLTESEKVTDSFNSIEEKLASDKFKLLASLEAHSNHPLAKSLKFQG
    DLYELTDLSELAGRGLSAKINGQEYFAGNDKLMTDLNLSVPETDDTVIYLANKEKLLAMAVFSSSLKDDALKTIQTLQKR
    GLKTVMLTGDNQNSAEKIQKLVHLDEVKSGLRPEEKAEIVQNSPNSMMVGDGINDAIALASATVGLAMATGSDIAMEAGD
    VTVTSGQLHKISTFFEVAKKTISKIKQNYFWAFVYNVIGIPLAAFGLLNPMLAAAAMSLSSVSVILNSLLLTKTKIKNVE


    >gi|15672827|ref|NP_267001.1| hypothetical protein L862989 [Lactococcus lactis subsp. lactis Il1403]
    MIKIYTVASCSSCKKAKEWLEKQNLAYQEINLVTSRICKEDILEILALTEEGTGDIISRRSQAYQRLNIDFETIKLNDLI
    QIIEENPTLLRRPLIVDHKRLQVGYNDDEIRKFLPRKKREIQIKVATEASYNLDIEEQFHEG

    >gi|15672828|ref|NP_267002.1| glutathione reductase [Lactococcus lactis subsp. lactis Il1403]
    MFDYIIIGAGPGGLGLAYRLKTKDNKIGIIENDKWGGTCPNYGCDPTKMMMAVVEAKSRVEQLKGQGISGELNIDWKGLK
    SRKLNITDPYEKSTFTGLKNAGIETIYGSAAFNDQGKLEVEGKTYQAKTYIIATGSRPRLLDIDGKEFLKTSNDFLALEE
    FPAQISFLGSGPISLELAQIAKAAGSDVTIISRKKARVAHFDEEMGQEFINYLKAQGIKFIEDISVDKVEKVADGFLLTD
    GTDFEHKTDLVIAGVGRQPNSDKLNLEKVGVETDAKGIKVNEYLQTSNSKIYAMGDVLSKNQPHLTPVSSFEGAYLGENL
    VKDEPQKIAYPAIPTIIFGTAKLAEVGHLAGEGIHTKTLDLSSWYTYKRINDPLAKLKVALNEKREIVGASTVSSVADEV
    INLINILIQQKMTLADVEKMIFTYPTVASDLEYFY

    >gi|15672922|ref|NP_267096.1| thioredoxin reductase [Lactococcus lactis subsp. lactis Il1403]
    MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMGPELSMKMAEPLEGLGVENAY
    GFVTAIEDHGDYKKIITEDDEFVTKSIIIATGANHRKLEIPGEEEYGARGVSY
    CAVCDGAFFRNQEILVIGGGDSAVEEA
    LYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKVQSVVYKNVKTGEVTEKAFGGIFIYVGL
    DPVAEFAGNLGITDEAGWIITDDHMRTSLPGIFAVGDVRQKDFRQITTAIGDGAQAAQEAYKFVAELD

    >gi|15673043|ref|NP_267217.1| hypothetical protein L72684 [Lactococcus lactis subsp. lactis Il1403]
    MIKIYLSGSCSSCRKAKKWLRKHHIEFEEINLSKDFMEKDDLIKILSLTENGFEDIIATRGKTYASLNYNFDELGLEKAF
    GLIQENPRLLKRPLIFDEDCLLIGFNEDGIRAFIPPEVRRIELRERLILV

    >gi|15673199|ref|NP_267373.1| hypothetical protein L38177 [Lactococcus lactis subsp. lactis Il1403]
    MTQDYRVLLYYQYVPIEDGETFAQKHLADCKELGLKGRILVADEGINGTVSGTIEQTNAYMELMKNDPRFSSTIFKIDEA
    EQNAFKKMHVRYRPELVNLSLEDDVNPLELTGAYLDPKEFREAMLDENTVVIDARNDYEFDLGHFRGAIRPEIRSFRELP
    QWIRDNKEQFMEKRVLTY
    CTGGIRCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKE
    HVIVGRDWFDGSPCERYINCGNPECNRQMLASEENEAKYLGACSHECRVHPNNRYIKAHQLSNQEVQERLALLEKDLAS

    >gi|15673306|ref|NP_267480.1| hypothetical protein L158193 [Lactococcus lactis subsp. lactis Il1403]
    MIKLFSSTNCSSSKKMKQWLITNKLEFEEISILENTLLKKDILRILSLTETGVEEIISKRSSAYKKLSKIIDFDALTLNS
    LVELIVQNQKLLRRPLVVDEHRLQVGYNEDDIRKFLPRKVRQLGLITAIENVRIWDQAK

    >gi|30024038|ref|NP_267520.2| glutathione peroxidase [Lactococcus lactis subsp. lactis Il1403]
    MNFYDFSAFKMNGETVSMSDFKGKVVIVVNTASKCGFTPQFEGLEKLYENYKDQGLEILGFPCNQFVNQDAGENSEINEF
    CQLNYGVTFPMFQKIKVNGKEAHPLYQFLKKEAKGALSGTIKWNFTKFLIDREGNVIERFAPKTEPKEMEEEIQKLL

    >gi|15673535|ref|NP_267709.1| peptide methionine sulfoxide reductase [Lactococcus lactis subsp. lactis Il1403]
    MSTERAIFAGGCFWCMVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLDIYWSLID
    PTDADGQIYDRGANYRPVIFVESEEQRIAAQKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDPKRYQAMHK
    ARERYLALQRFKGKFKFLRKNTR

    >gi|15673626|ref|NP_267800.1| thioredoxin [Lactococcus lactis subsp. lactis Il1403]
    MEYNITDATFDEETKEGLVLIDFWATWCGPCRMQAPILEQLSEELDESELKICKMDVDENPATAQGFGIMSIPTLMFKKD
    GEEVKRIVGVQTKAQLKAVIAELS

    >gi|15673988|ref|NP_268163.1| methionine sulfoxide reductase A [Lactococcus lactis subsp. lactis Il1403]
    MATERAIFAGGCFWCMVQPFEEREGILSVISGYTGGNVENPTYEQVKKHLTGHTEAVEIIFDNSKITYQSLVELYWTLTD
    PTDAFGQFEDRGDNYRPVIFVENEEQEKIAKESKAQLQASGNFDSPIVTSIETVQKFWPAEDYHQGFYKKNPEDYAQSSK
    IRHDFLEKQWKK

    >gi|30024072|ref|NP_835336.1| hypothetical protein L200079 [Lactococcus lactis subsp. lactis Il1403]
    METRHFKNIIIGFGKAGRALAKTLSQHGEEALIIERDQAMYGGTCPNVGCAPSKTLIVAGQKKI

    >gi|15674047|ref|NP_268222.1| hypothetical protein L134080 [Lactococcus lactis subsp. lactis Il1403]
    MSKIVMKLDELSCPSCMAKIEGALNTTNGVEMAKVLFNASKVKAEFDDNQVTATDLVSKVEGLGYVVQKSKVTEI