Lactococcus lactis cremoris SK11 uid57983

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116326581|ref|YP_796502.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactococcus lactis subsp. cremoris SK11]
    MKKIDVKNIVVGFGKGGKTLAKFLSGKGESVVVIEQSTLMYGGTCINIGCIPSKFLIVNGEKGLKFTEASEKKAMLTGNL
    NLKNYHMIADEATAEVIDGKAKFVSDHEIEVMDAEGEVIAQLIGERIFINTGATPVLPPIPGLVDSRNVVTSTELMDLKQ
    LPEHLTIIGSGYIGLEFASMFASYGSKVTVLDIFDNFLPRDDEDISKLVRSDLESRGIIFKLGVKIDAITDNSVEIINKE
    GKKVSILSDKILVATGRKPNTAGLGLENTNIQLGQRGEIVVNDKLETTVQNVWALGDVHGGLQFTYTSLDDFRIVSNNLY
    GDGKRSLSDRKNVPTSVFITPALSKVGLNEKDAKAAGIDYRLFKLAATAIPKSAVLNQSKGLLKALVDPETDKILGITIY
    AEESYETINLVSLAIEVGLPYTLLRDKIYTHPTMTEALNDLFAAKNEVK

    >gi|116510882|ref|YP_808098.1| dihydrolipoamide dehydrogenase [Lactococcus lactis subsp. cremoris SK11]
    MVVGAQATEVDLVIIGSGPGGYVAAIRAAELGKKVTIIEKDNVGGVCLNIGCIPSKALINIGHHYQESLEEEKGENPFGL
    SVGNVKLNWESAQKWKQDKVVNQLTGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIP
    SFPFGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDKEMSDIIANRVKSAGSEIF
    TSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRPNTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDV
    VPGPMLAHKASFQAKVAAAAIAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDTT
    GFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAIMDTAELADGLPIHV

    >gi|116510892|ref|YP_808108.1| redox protein, regulator of disulfide bond formation [Lactococcus lactis subsp. cremoris SK11]
    MANKSKASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQAHITTPEELLGAAHAACFSMAFSMVLGQKGLVAKSI
    DTTADVTFETTADGPAITKIKLTNHSVIPGISEADFQEIAKIVKES
    CPVSKALATVNIELEATLG

    >gi|116511019|ref|YP_808235.1| methionine sulfoxide reductase B [Lactococcus lactis subsp. cremoris SK11]
    MKKEELKKKLSPLAYRVTQENGTEAPFTNEFDDFFEKGLYVDIVSGEPLFTSLDKYQSGCGWPAFTQPIDKKMVKEKRDK
    SLFMERTEVRSSNADSHLGHVFTDGPLDKGGLRY
    CINSAALRFIPFDQLESEGYGDYIKYFS

    >gi|116511080|ref|YP_808296.1| flavoprotein [Lactococcus lactis subsp. cremoris SK11]
    MTKSAKTFDVIVVGAGPSGMMAAISAAENGAKVALIDKNKKVGKKLLMTGGGRCNVTNSRSVDEILANVPGNGRFLHSAF
    SQFSNLDIINFFESNGVKLKEEDHGRMFPLTDKSKTIVDALFNKILSLHVSYFPSQPVSQLIIENGAIVGLETDSESYLS
    PTIVLSTGGRAYPSTGSTGDGYRLARSAGHTISQLYATEAALLSDESFILDKSLQGISLREIKLSVVNAKGKTVISHQHD
    LLFTHFGLSGPAALRCSSFINQLLEKGETPVMVSLDQFPDKSAGFLKNELTKLASSDKSIKNAFSGLTQERMLLFILEKA
    GINPALPAKSLSEQQIEKLVQLFKNWQIIINKTLPIEKSFVTGGGVSLKEVNPKSMESKKTQGLFMTGELLDINGYTGGY
    NITCAFVTGFVAGKHAAEIASYFQ

    >gi|116511153|ref|YP_808369.1| thiol peroxidase [Lactococcus lactis subsp. cremoris SK11]
    MTMNITSHGEKIATINPTTSGDAPDFELTDLKGNKIKLSKLEKPVLISVFPDINTRVCSLQTKHFNLEAAKHSEIDFLSI
    SNNTADEQKNWCAAEGVEMTILADDGTFGQAYGIVLNDGPLKGRLARSVFVVKGGQIVYSEILAELSDEPNYEKALEATK


    >gi|116511196|ref|YP_808412.1| peroxiredoxin [Lactococcus lactis subsp. cremoris SK11]
    MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWNVLCFYPADFSFVCPTELEDLEETYPELKKLGVEVYSASTDTHFVHA
    AWHDHSDAISKITYPMLADPSQKISRAFDVLDEEAGLAQRGTFIIDPDDVIQAFEITADGIGRDASQLIDKIKAAQYVRN
    HPGEVCPAKWKEDGESLHVGIDLVGKI

    >gi|116511197|ref|YP_808413.1| Alkyl hydroperoxide reductase, large subunit [Lactococcus lactis subsp. cremoris SK11]
    MILDENLRSQLLPYMDLLENPIILKVDANDSENGQKINEFTDELASLSDLISKEKTNLNHKPAFSIEREGVSGVAFSGLP
    LGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFDTYVSLT
    CHNCPDVVQALNTMTILNPNISHTMIEGGMFQEE
    VEAKGIMAVPAVFKNAEEFHSGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
    GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLENGATLKSKAVILSTGARWRDL
    GIPGEQRFKNKGVAY
    CPHCDGPLFSGKDVAVIGGGNSGIEAAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVL
    TNVETKEILGDEQVTGLNYQVRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
    DTVYKQIIVSMGSGATASLGAFDYLIRN

    >gi|116511238|ref|YP_808454.1| hypothetical protein LACR_0428 [Lactococcus lactis subsp. cremoris SK11]
    MVKHLFNSHIDWVGGRNSIGDLQAGALNEKISIPETMAGPGVGTNPDEMLLGAASTCYSITLAAMLERNEIPLEHLKVEG
    QGVVDVTKGIFTYEKITYHVFMKLAAGADESKAIKLAERAESS
    CMISRAIQGNIELETIIKIEK

    >gi|116511245|ref|YP_808461.1| Thiol-disulfide isomerase and thioredoxin [Lactococcus lactis subsp. cremoris SK11]
    MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIETENPEFRFVEVDRDEYMDLAIEWGIMGIPSFVVIEDG
    QEKARLVNKLRKTKEEVNTFLASAK

    >gi|116511247|ref|YP_808463.1| NADH oxidase [Lactococcus lactis subsp. cremoris SK11]
    MKIVVIGTNHAGIATANTLLEQYPGHEIVMIDRNSNMSYLGCGTAIWVGRQIEKPDELFYAKAEDFEAKGVKILTETEVS
    EIDFANMKVYAKTKSDDEIIEAYDKLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDAEFTKEKVKRIAVIGAGYIG
    TEIAEAAKRRGKEVLLFDDENTSLASYYDEEFAKGMDENLAQHGIELHFGELAKEFKANEEGYVSQIVTNKATYDVDLVI
    NCIGFTANSALASDKLATFKNGAIKVDKHQQSSDPDVYAVGDVATIYSNALQDFTYIALASSAVRSGIVAGHNIGGKELE
    SVGVQGSNGISIFGYNMTSTGLSVKAAKKLGLEVSFSDFEDKQKAWFLHENNDIVKIRIVYETNSRRIIGAQLASKSEII
    AGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK

    >gi|116511344|ref|YP_808560.1| arsenate reductase [Lactococcus lactis subsp. cremoris SK11]
    MIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRQILTKTENGTEDIISTRSKVFQKLAVDVDNLTINELL
    DLVTEFPNLLRRPIITDSKHLQIGFNEDEIRAFLPREYRRAEMLTTID

    >gi|116511471|ref|YP_808687.1| transcriptional regulator Spx [Lactococcus lactis subsp. cremoris SK11]
    MITIYTAPSCTSCKKAKTWLSYHHIPFNERNLIADPLSTTEISQILQKCDDGVEGLISSRNRFVKTLGVDFEDISLSQAI
    KIISENPQIMRRPIIMDEKRLHVGYNEEEIRAFLPRTVRVLENGGARLRSAI

    >gi|116511593|ref|YP_808809.1| rhodanese-related sulfurtransferase [Lactococcus lactis subsp. cremoris SK11]
    MQTIDAGQLKLLIENKKAIIIDVREDFEYRNGHVPGAKNLPLSQLEEKYQEITDGNYIICQSGARSARACQYLLAKGIET
    INISGGTSAWDGQLDFD

    >gi|116511594|ref|YP_808810.1| fused NAD(FAD)-dependent dehydrogenase/rhodanese domain-containing protein [Lactococcus lactis subsp. cremoris SK11]
    MTEKILIVGGVAGGMSAATRLRRLQEKAEIIVFEKGPYVSFANCGLPYYVGGEIEERENLIVQSSKALQKRFNLDVRENS
    EVTAIDSKEKKITVLSNGKSYFESYDKLILSPGAKPFVPQIKGLDLANNVFTLRNIPDVDKIMAQLKEKAPKKATIIGAG
    FIGIEMAENLAKRGIAVTIVEKAPHVLPTLDREMAAYVNEELIKNNVSVMTNTGAVEFKDKQILLDNGESLLSDLTILSV
    GIQPETSLAKMADIKLGLRNAILVDEHYETSVKDIYAVGDAIVVKNQLGHDALISLASPANRQGRQVADIISGLPVENRG
    SLGTAIVRVFDLQVASTGLSESQLQSLNLKHKIVHVTANNHAGYYPGATSIVLKLIFEPESGETFGAQALGKEGVDKRID
    ILSTAIKAKLTVFDLPELEFTYAPPFGSAKDPVNMAGYAAMNIILGQSENIQWHELADELAKGKVLLDVRNPAELIKGKF
    KNSQNIPLDELRERLNELDKKIQYIVSCQSGLRSYNAERILKQEGYQVKNLDGAFGLYSKVTNDLIE

    >gi|116511596|ref|YP_808812.1| arsenate reductase [Lactococcus lactis subsp. cremoris SK11]
    MYDFYWYPKCSTCRKAKAKLDELGIDYQAIDLKETPPSQQKFEKWFKEADFPIKKFFNTSGLVYRDLNLKDKLATLSEKE
    MAELLSSNGMLIKRPLLVKNDQVQQIGFKESSYKKI

    >gi|116511645|ref|YP_808861.1| mercuric reductase [Lactococcus lactis subsp. cremoris SK11]
    MKETLKIDGMTCDHCVMHVTNALESVEGVEKAKVSLKKKEALVKFDAPANLDQMALAVAEAGYKVI

    >gi|116511646|ref|YP_808862.1| copper/potassium-transporting ATPase [Lactococcus lactis subsp. cremoris SK11]
    MRSQSFVITGMTCANCVNTVSKTLNQSDKIVEATVNLATEKAKIVADDSLTDQEIINLVEKAGYGAIVNDKAHQEKIARQ
    AARKARNLSLSFWISLILTLPLVVAMFADIFGVHANWVMLLHEPLLQLILASPVQFIVGWRFYVGAYHALRNKSANMDVL
    VALGTSVAYFSSLILAVFMGQKNALNFESSMVIITLVVMGKLLEHNAKEKTTQAITGLMSSRASFVHTESADLAIEEVQM
    GQVIRILPGEKVPLDAMILSGKASFDESILTGESLPVVKMDDEIVFEGTINLDGEVKAVVVHDLNDSTISRMVEMMSEAQ
    GSKPNIQKLADKISGIFVPIVLAIALVTFVATWAISGILLTAIMHAVAVLVIACPCALGLATPTAIISGTGLAAKNGLLI
    KNANALELAGLVDTIFFDKTGTITTGEFELTDFKLLTENEKNTDRTESIKSKMLTDEFKILASLEAHSNHPLAKSLKFSG
    DFYDLTDLSELAGRGLSAKINGQEYFAGNDKLMTELNLSVPETEDTVIYLADKEKLLAMAIFSSSLKEDSVDTIRVLQKR
    GIKTVMLTGDNANSAAKIQELIHLDEIKSGLRPEEKAEIVQSTPNSMMVGDGINDAIALASATVGLTMATGSDIAMEAGD
    VTVIGGQLHKISTFFEVAKKTISKIKQNYFWAFVYNIIGIPLAAFGLLNPMLAAAAMSLSSVSVILNSLLLTKAKIKSVD


    >gi|116511665|ref|YP_808881.1| arsenate reductase [Lactococcus lactis subsp. cremoris SK11]
    MIKIYTVASCSSCKKAKEWLEKHQLAYQEINLVTNHIGREDLLEILSLTEGGTVDIISKRSQAYERLNIDFESIKLNDLV
    ELIEMNPTILRRPLIIDNKRLQVGYNDDEIRKFLPRKMRKIQIEAATERLYQFDLEEQFQEG

    >gi|116511666|ref|YP_808882.1| glutathione reductase [Lactococcus lactis subsp. cremoris SK11]
    MFDYIIIGAGPGGLGLAYRLKTKDNKIAMIENDKWGGTCPNYGCDPTKMMMAVIEAKSHVEHLKGQGISGDLKIDWKGLR
    SRKLNITDPYEKSTFEGLKNADIETIYGSASFTEQGELQVAGEIYQAKTYIIATGSRPRRLELDGDEFLKTSNDFLALEE
    LPAKISFMGSGPISLELAQIAKAAGSDVTIISRKKSNVAHFDEEMGQEFINYLKNQGINFIENISVSKVEKFTDGFLLTD
    GAGFEHKTDLVIAGVGRQPNSDQLNLDKVGVETDHKGIKVNDYLQTSNPKIYAMGDVLSKAEPHLTPVSSFEGNYLGQNL
    PNANKVPIHYPQIPTIIFGTAKLAEVGILTGTGIRTKSLNLKSWYTYKRINDPLAKLKVAINENQEIVGASTVSSVADEV
    INLISILIQQKMTLADVEKMIFTYPTVASDLEYFY

    >gi|116511757|ref|YP_808973.1| thioredoxin reductase [Lactococcus lactis subsp. cremoris SK11]
    MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMGPELSMKMAEPLEGLGVENAY
    GFVTDIEDHGDYKKIITEDDEFITKSIIIATGANHRKLEIPGEEEYGARGVSY
    CAVCDGAFFRNQEILVIGGGDSAVEEA
    LYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGL
    DPVAEFVSDLGITDGAGWIITDDHMRTSIPGIFAVGDVRQKDFRQITTAVGDGAQAAQEAYKFVVELG

    >gi|116511786|ref|YP_809002.1| hypothetical protein LACR_1043 [Lactococcus lactis subsp. cremoris SK11]
    MSKIIMKLDELSCPSCLAKIEGAMTGTKGVISAKVLFNASKVKAEFDENIVKSDELVTKVEKLGYPVQSSKVTLV

    >gi|116511806|ref|YP_809022.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Lactococcus lactis subsp. cremoris SK11]
    MVTVYSKNNCMQCKMVKKWLSEHEIAFNEINIDEQPEFVEKVIEMGFRAAPVITKDDFAFSGFRPSELAKLA

    >gi|116511897|ref|YP_809113.1| arsenate reductase [Lactococcus lactis subsp. cremoris SK11]
    MIKIYLSGSCSSCRKAKKWLRKRHIEFEEINLTKDIMEKDDLIKILSLTENGLEDVIATRGKTYSGLNHNFDELGLEEAY
    RLIQENPRLLKRPLIFDEQRLLIGFNEDGIRAFIPPEVRRVELRERLILI

    >gi|116512054|ref|YP_809270.1| hypothetical protein LACR_1324 [Lactococcus lactis subsp. cremoris SK11]
    MTQDYRVLLYYQYVPIEDGESFAQKHLSDCKALGLKGRILVADEGINGTVSGTVEQTNAYMSLMKNDSRFTSTIFKIDEA
    KQNAFKKMHVRYRPELVNLSLEDDVNPLELTGAYLDPKEFREAMLDENTVVIDARNDYEFDLGHFRGAIRPEIRSFRELP
    QWIRDNKEQFMEKRVLTY
    CTGGIRCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQGDLWYGQMYVFDSRIAVPINQKE
    HVIVGRDWFDGSPCERYINCGNPECNRQMLASKENEAKYLGACSHECRVHPDNRYIKAHQLSNQEVQERLALLEKDLAS

    >gi|116512214|ref|YP_809430.1| glutathione peroxidase [Lactococcus lactis subsp. cremoris SK11]
    MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILGFPCNQFANQDAGENTEINEF
    CQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGTIKWNFTKFLIDQDGQVIERFAPKTEPEEMEEEIKKLL

    >gi|116512348|ref|YP_809564.1| peptide methionine sulfoxide reductase [Lactococcus lactis subsp. cremoris SK11]
    MSTERAIFAGGCFWCMVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAIEILFDNELISYDELLDIYWSLID
    PTDADGQIYDRGANYRPVIFVESEEQKTAAKKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDPKRYQAMHK
    ARERYLALQRFKGKFKFLRKNTR

    >gi|116512506|ref|YP_811413.1| Thiol-disulfide isomerase or thioredoxin [Lactococcus lactis subsp. cremoris SK11]
    MEYNITDATFDEETKEGLVLIDFWATWCGPCRMQAPILEQLSEELDESELKICKMDVDENPATAQGFGIMSIPTLMFKKD
    GEEVKRIVGVQTKAQLKAVVAELS

    >gi|116512950|ref|YP_811857.1| methionine sulfoxide reductase A [Lactococcus lactis subsp. cremoris SK11]
    MATERAIFAGGCFWCMVQPFEEREGILSVTSGYTGGNVENPTYEQVKMHLTGHTEAVEIIFDNSKINYQTLVELYWTLTD
    PTDAFGQFEDRGDNYRPVIFVENNEQEKIAKESKAQLQASGNFDSPIVTSIEKTQKFWPAEDYHQGFYRKNPEDYAQSSK
    IRHDFLEKQWEDK