Lactococcus lactis cremoris MG1363 uid58837

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|125622950|ref|YP_001031433.1| dihydrolipoamide dehydrogenase [Lactococcus lactis subsp. cremoris MG1363]
    MVVGAQATEVDLVVIGSGPGGYVAAIRAAELGKKVTIIEKDNVGGVCLNIGCIPSKALINIGHHYQESLEEEKGENPFGL
    SVGNVKLNWESAQKWKQDKVVNQLTGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIP
    SFPFGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDKEMSDIIANRVKSAGSEIF
    TSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRPNTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDV
    VPGPMLAHKASFQAKVAAAAIAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNNTT
    GFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAIMDTAELADGLPIHV

    >gi|125622959|ref|YP_001031442.1| osmotically inducible protein C [Lactococcus lactis subsp. cremoris MG1363]
    MANISKASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQAHITTPEELLGAAHAACFSMAFSMVLGQKGLVAKSI
    DTTADVTFETTADGPAITKIKLTNHSVIPGISEADFQEIAKTVKES
    CPVSKALAAVNIELEATLG

    >gi|125623078|ref|YP_001031561.1| methionine sulfoxide reductase B [Lactococcus lactis subsp. cremoris MG1363]
    MKKEELKKKLSPLAYRVTQENGTEARFTNEFDDFFEKGLYVDIVSGEPLFTSLDKYQSGCGWPAFTQPIDKKVVKEKRDK
    SLFMERTEVRSSNADSHLGHVFTDGPLDKGGLRY
    CINSAALRFIPFDQLESEGYGDYIKYFS

    >gi|125623138|ref|YP_001031621.1| putative flavoprotein [Lactococcus lactis subsp. cremoris MG1363]
    MTKSAKTFDVIVVGAGPSGMMAAISAAENGAKVALIDKNKKVGKKLLMTGGGRCNVTNSRSVDEILANVPGNGRFLHSAF
    SQFSNLDIINFFESNGVKLKEEDHGRMFPVTDKSKTIVDALFNKILSLHVSYFPSQAVSQLIIENGAIVGLETDSESYLS
    PTIVLSTGGRAYPSTGSTGDGYRLARSAGHTISQLYATEAALLSDESFILDKSLQGISLREIKLSVVNAKGKTVISHQHD
    LLFTHFGLSGPAALRCSSFINQLLEKGETPVMVSLDQFPDKSAGFLKNELTKLASSDKSIKNAFSGLTQERMLLFILEKA
    GINPALPAKSLSEQQIEKLVQLFKNWQIMVNKTLPIEKSFVTGGGVSLKEVNPKSMESKKTQGLFMTGELLDINGYTGGY
    NITCAFVTGFVAGKHAAEIASYFQ

    >gi|125623189|ref|YP_001031672.1| thiol peroxidase [Lactococcus lactis subsp. cremoris MG1363]
    MTMNITSHGEKIATINPTTSGDAPDFELTDLKGNKIKLSKLEKPVLISVFPDINTRVCSLQTKHFNLEAAKHSEIDFLSI
    SNNTADEQKNWCAAEGVDMTILADDGTFGQAYGLVLNDGPLKGRLARSVFVVKEGQIVYSEILAELSDEPNYEKALEATK


    >gi|125623226|ref|YP_001031709.1| alkyl hydroperoxide reductase subunit C [Lactococcus lactis subsp. cremoris MG1363]
    MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWNVLCFYPADFSFVCPTELEDLEETYPELKKLGVEVYSASTDTHFVHA
    AWHDHSDAISKITYPMLADPSQKISRAFDVLDEEAGLAQRGTLIIDPDGVIQAFEITADGIGRDASQLIDKIKAAQYVRN
    HPGEVCPAKWKEDGESLHVGIDLVGKI

    >gi|125623227|ref|YP_001031710.1| alkyl hydroperoxide reductase subunit F [Lactococcus lactis subsp. cremoris MG1363]
    MILDENLRSQLLPYMDLLENPIILKVDADDSENGQKINEFTDELASLSDLISKEKTNLNHKPAFSIEREGVSGLVFSGLP
    LGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFDTYVSLT
    CHNCPDVVQALNTMTILNPNISHTMIEGGMFQAE
    VEAKGIMAVPAVFKNGEEFHSGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
    GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLANGATLKSKAVILSTGARWRDL
    GIPGEQRFKNKGVAY
    CPHCDGPLFSGKDVAVIGGGNSGIEAAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVL
    TNVETKEILGDEQVTGLNYQVRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
    DTVYKQIIVSMGSGATASLGAFDYLIRN

    >gi|125623266|ref|YP_001031749.1| hypothetical protein llmg_0398 [Lactococcus lactis subsp. cremoris MG1363]
    MVKHLFNSHIDWVGGRNSIGDLQAGALNEKISIPETMAGPGVGTNPDEMLLGAASTCYSITLAAMLERNEIPLEHLKVEG
    QGVVDVTKGIFTYEKITYHVFMKLAAGADESKAIKLAERAESS
    CMISRAIQGNIKLETIIKIEE

    >gi|125623273|ref|YP_001031756.1| thioredoxin H-type [Lactococcus lactis subsp. cremoris MG1363]
    MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIETENPEFRFVEVDRDEYMDLAIEWGIMGIPSFVVIEDG
    QEKARLVNKLRKTKEEVNTFLASAK

    >gi|125623275|ref|YP_001031758.1| NADH oxidase [Lactococcus lactis subsp. cremoris MG1363]
    MKIVVIGTNHAGIATANTLLEQYPGHEIVMIDRNSNMSYLGCGTAIWVGRQIEKPDELFYAKAEDFEAKGVKILTETEVS
    EIDFANKKVYAKTKSDDEIIEAYDKLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDAEFAKEKVKRIAVIGAGYIG
    TEIAEAAKRRGKEVLLFDAENTSLASYYDEEFAKGMDENLAQHGIELHFGELAKEFKANEEGYVSQIVTNKATYDVDLVI
    NCIGFTANSALASDKLATFKNGAIKVDKHQQSSDPDVYAVGDVATIYSNALQDFTYIALASNAVRSGIVAGHNIGGKELE
    SVGVQGSNGISIFGYNMTSTGLSVKAAKKLGLEVSFSDFEDKQKAWFLHENNDSVKIRIVYETKSRRIIGAQLASKSEII
    AGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK

    >gi|125623365|ref|YP_001031848.1| 6-O-methylguanine-DNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363]
    MLYKASYQSPLGEMSLLSDETYLLGLWFNEQKYFGSAYDLNLAQKDESLPITEAIEWLNQYFRGENPNSQKIKLKPEVTE
    FRKRVLKILSDIPYGTLITYKEISNLLQINDEKKRNMSQAVGGAVGHNPISIIIP
    CHRVVGSDGSLTGYAGGLDKKRALL
    ALEQNSLIK

    >gi|125623381|ref|YP_001031864.1| hypothetical protein llmg_0514 [Lactococcus lactis subsp. cremoris MG1363]
    MGNRTVIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRQILTKTENGTEDIISTRSKVFQKLAVDVDNLT
    INELLDLVTEFPNLLRRPIITDSKHLQIGFNEDEIRAFLPREYRRAEMLTTID

    >gi|125623500|ref|YP_001031983.1| transcriptional regulator Spx [Lactococcus lactis subsp. cremoris MG1363]
    MITIYTAPSCTSCKKAKTWLSYHHIPFNERNLIADPLSTTEISQILQKCDDGVEGLISSRNRFVKTLGVDFEDISLSQAI
    KIISENPQIMRRPIIMDEKRLHVGYNEEEIRAFLPRTVRVLENGGARLRSAI

    >gi|125623548|ref|YP_001032031.1| hypothetical protein llmg_0692 [Lactococcus lactis subsp. cremoris MG1363]
    MSKVIMRLNELSCPSCMAKIEAAMTTTKGVANAKVLFNASKVKAEFDENVVSADELISKVEKLGYPVLSSKVTVV

    >gi|125623631|ref|YP_001032114.1| thioredoxin [Lactococcus lactis subsp. cremoris MG1363]
    MEYNITDATFDKETKEGLVLIDFWATWCGPCRMQAPILEQLSEELDESELKICKMDVDENPATAQGFGIMSIPTLMFKKD
    GEEVKRIVGVQTKAQLKAVIAELS

    >gi|125623790|ref|YP_001032273.1| MsrA protein [Lactococcus lactis subsp. cremoris MG1363]
    MSTERAIFAGGCFWCMVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLDIYWSLID
    PTDADGQIYDRGANYRPVIFVESEEQKTAAKKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDPKRYQAMHK
    ARERYLALQRFKGKFKFLRKNTR

    >gi|125623919|ref|YP_001032402.1| gluthatione peroxidase [Lactococcus lactis subsp. cremoris MG1363]
    MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILGFPCNQFANQDAGENTEINEF
    CQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGTIKWNFTKFLIDRDGQVIERFAPKTEPEEMEEEIKKLL

    >gi|125624074|ref|YP_001032557.1| hypothetical protein llmg_1249 [Lactococcus lactis subsp. cremoris MG1363]
    MKIIIIGSVASGTSVAAKARRNTESAEITLYDKDTDISYAVCGIPYAIGGEIGDFDELTPRDARWFKKRYNVDIHTSHEV
    LDINHSTKSLKVKNLLTGEIFDDSYDILVFATGATYHRPEVFQGKSFDNVFQVRNINSGKNIKSFLDDKKPKTAIVVGAG
    YIGLEVAEQLKERGLDVTVLQRGKHPMAHLDWDMSIRIEDEMEKQNVHFLSEEIVTETRGEQTLKSVITSKGNVLSADLY
    ILATGVRPNTQLAESIGVKLGETGAIATDTTMETNIEGVYAVGDVAESFHVITGKATYRPLASTANKMGRIAGDAMTGGP
    LRFQGVLGTGILRFFDLTIAQTGLTEKEAIEEGYEIAVLFNIKPDKPDYMHGKEMVIKAVADKLSHRILGVQIIGPQGVD
    KRIDVFASTITLGVTAEDLFHMDLAYAPPFSTTKDPVAYTGMALTNALTTAPLITPHDLMELQKNSADITIIDTRAKASY
    EKKHIPNAINIPLAELREKSSILDKDKLTIVY
    CNKGVTGNASQNVLRNEGFREVYNLSGGNKNYQEIAKQEKN

    >gi|125624109|ref|YP_001032592.1| hypothetical protein llmg_1287 [Lactococcus lactis subsp. cremoris MG1363]
    MTQDYRVLLYYQYVPIEDGESFAQKHLSDCKALGLKGRILVADEGINGTVSGTVEQTNAYMSLMKNDSRFTSTIFKIDEA
    KQNAFKKMHVRYRPELVNLSLEDDVNPLELTGAYLDPKEFREAMLDENTVVIDARNDYEFDLGHFRGAIRPEIRSFRELP
    QWIRDNKEQFMEKRVLTY
    CTGGIRCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKE
    HVIVGRDWFDGSPCERYINCGNPECNRQMLASKENEAKYLGACSHECRVHPDNRYIKAHQLSNQEVQERLALLEKDLAS

    >gi|125624317|ref|YP_001032800.1| hypothetical protein llmg_1513 [Lactococcus lactis subsp. cremoris MG1363]
    MIKIYLSGSCSSCRKAKKWLRKRHIEFEEINLTKDIMEKDDLIKILSLTENGLEDVIATRGKTYSGLNHNFDELGLEEAY
    RLIQENPRLLKRPLIFDEQRLLIGFNEDGIRAFIPPEVRRVELRERLILI

    >gi|125624344|ref|YP_001032827.1| glutaredoxin-like protein nrdH [Lactococcus lactis subsp. cremoris MG1363]
    MVTVYSKNNCMQCKMVKKWLSEHEIAFNEINIDEQPEFVEKVIEMGFRAAPVITKDDFAFSGFRPSELAKLA

    >gi|125624390|ref|YP_001032873.1| TrxB1 protein [Lactococcus lactis subsp. cremoris MG1363]
    MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMGPELSMKMAEPLEGLGVENAY
    GFVTGIEDHGDYKKIITEDDEFITKSIIIATGANHRKLEIPGEEEYGARGVSY
    CAVCDGAFFRNQEILVIGGGDSAVEEA
    LYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGL
    DPVAEFVSDLGITDEAGWIITDDHMRTNIPGIFAVGDVRQKDFRQITTAVGDGAQAAQEAYKFVVELG

    >gi|125624497|ref|YP_001032980.1| glutathione reductase [Lactococcus lactis subsp. cremoris MG1363]
    MFDYIIIGAGPGGLGLAYRLKTKDNKIAMIENDKWGGTCPNYGCDPTKMMMAVIEAKSHVEHLKGQGISGDLKIDWKGLR
    SRKLNITDPYEKSTFEGLKNADIETIYGSASFTEQGELQVAGEIYQAKTYIIAAGSRPRRLELDGDEFLKTSNDFLALEE
    LPAKISFMGSGPISLELAQIAKAAGSDVTIISRKKSNVAHFDEEMGQEFINYLKNQGINFIENISVSKVEKFTDGFLLTD
    GAGFEHKTDLVIAGVGRQPNSDQLNLDKVGVETDHKGIKVNDYLQTSNPKIYAMGDVLSKAEPHLTPVSSFEGNYLGQNL
    PNANKVPIHYPQIPTIIFGTAKLAEVGILTGTGIRTKSLNLKSWYTYKRINDPLAKLKVAINENQEIVGASTVSSVADEV
    INLISILIQQKMTLADVEKMIFTYPTVASDLEYFY

    >gi|125624498|ref|YP_001032981.1| hypothetical protein llmg_1703 [Lactococcus lactis subsp. cremoris MG1363]
    MIKIYTVASCSSCKKAKEWLEKHQLAYQEINLVTNHIGREDLLEILSLTEGGTVDIISKRSQAYERLNIDFESIKLNDLV
    ELIEMNPTILRRPLIIDNKRLQVGYNDDEIRKFLPRKMRKIQIEAATERLYQFDLEEQFQEG

    >gi|125624520|ref|YP_001033003.1| copper/potassium-transporting ATPase [Lactococcus lactis subsp. cremoris MG1363]
    MRSQSFVITGMTCANCVNTVSKTLNQSDKIVEATVNLATEKAKIVADDSLTDQEIINLVEKAGYGAIVNDKAHQEKIARQ
    AARKARNLSLSFWISLILTLPLVVAMFADIFGVHANWVMFLHEPLLQLILASPVQFIVGWRFYVGAYHALRNKSANMDVL
    VALGTSVAYFSSLILAVFMGQKNALNFESSMVIITLVVMGKLLENNAKEKTTQAITGLMSSRASVVHTESADLAIEEVEM
    GQVIRILPGEKVPLDAIILSGKASFDESILTGESLPVVKMDDEIVFEGTINLDGEVKAVVVHDLNDSTISRMVEMMSEAQ
    GSKPNIQKLADKISGIFVPIVLAIALVTFVATWAVSGILLTAIMHAVAVLVIACPCALGLATPTAIISGTGLAAKNGLLI
    KNANALELAGLVDTIFFDKTGTITTGEFELTDFKLLTENEKITDRTESIKSKMLTDEFKILASLEAHSNHPLAKSLKFSG
    DFYDLTDLSELAGRGLSAKINGQEYFAGNDKLMTDFNLSVPETEDTVIYLADKEKLLAMAIFSSSLKEDSVDTIRALQKR
    GIKTVMLTGDNANSAEKIQELIHLDEIKSGLRPEEKAEIVQSTPNSMMVGDGINDAIALASATVGLAMATGSDIAMEAGD
    VTVIGGQLHKISTFFEVAKKTISKIKQNYFWAFVYNIIGIPLAAFGLLNPMLAAAAMSLSSVSVILNSLLLTKAKIKSVD


    >gi|125624521|ref|YP_001033004.1| mercuric reductase [Lactococcus lactis subsp. cremoris MG1363]
    MKETLKIDGMTCDHCVMHVTNALESVEGVEKAKVSLKKKEALVKFDAPADLDQMALAVAEAGYKVI

    >gi|125624558|ref|YP_001033041.1| hypothetical protein llmg_1768 [Lactococcus lactis subsp. cremoris MG1363]
    MYDFYWYPKCSTCRKAKAKLDELGIDYQAIDLKETPPSQKNFEKWFKEADFPIKKFFNTSGLVYRDLNLKDKLATLSEKE
    MAELLSSNGMLIKRPLLVKNGQVQQIGFKESSYEKI

    >gi|125624560|ref|YP_001033043.1| NADH oxidase [Lactococcus lactis subsp. cremoris MG1363]
    MIEKILIVGGVAGGMSAATRLRRLNENAEIIVFEKGPYVSFANCGLPYYVGGEIAEREKLIVQSAKALKNRFNLEVRENS
    EVIAIDSEGKKVTVVSNGESYVESYDKLILSPGAKPLIPQIKGLNQATNVFSLRNIPDVDKIMAYLAAKESKSATIIGAG
    FIGLEMAENLAKRGLSVTIVEKAPHVLPTIDREMAAFVNEELIKNNLSVMTNRGAVEFKNDEILLDNGESLQSDLTILSV
    GIQPETSLAKSAGIKLGLRNAILVDEHYETSVKDIYAVGDAIVVKNQLGQDALISLASPANRQGRQVADIISGLSIKNRG
    SLGTAIVRVFDLQVASTGLSEFQLRGLKINHKIVHVTANNHAGYYPDATSIVLKLIFEPESGQIFGAQAIGKEGVDKRID
    ILSTAIKAKLTVFDLPELELTYAPPFGSAKDPVNMAGYAAINLLLGQSENIQWHELAAELAKGKVLLDVRKPNELAKGKF
    KNSQNIPLDDLRERLNELDKKTEYIVS
    CQSGLRSYNAERILKQEGYKVKNLDGAFGLYSKVTKELLD

    >gi|125624561|ref|YP_001033044.1| putative rhodanese-related sulfurtransferase [Lactococcus lactis subsp. cremoris MG1363]
    MFELFKKIKSISPAEVSTELKKGTQLIDVREAHEFQNGHIKGARNIPLSKLGEHVLAKNKKYLLICQSGMRSKKAYKILN
    KANYDVTNVNGGMRAWRGKIKK

    >gi|125624562|ref|YP_001033045.1| putative rhodanese-related sulfurtransferase [Lactococcus lactis subsp. cremoris MG1363]
    MEIINLTYIPLGVYNYYKSNNQEVKMQTIDISELELLTESENPVIVDVREDFEYNSGHVPNAKNIPLSQLEERYAEITDG
    TYII
    CQSGARSARACQYLSTKGIDTINISGGTIAWNGPLVFTDRL

    >gi|125625046|ref|YP_001033529.1| methionine sulfoxide reductase A [Lactococcus lactis subsp. cremoris MG1363]
    MATERAIFAGGCFWCMVQPFEEREGILSVTSGYTGGNVENPTYEQVKMHLTGHTEAVEIIFDNSKINYQTLVELYWTLTD
    PTDAFGQFEDRGDNYRPVIFVENNEQEKIAKESKAQLQASGNFDSPIVTSIEKTQKFWPAEDYHQGFYRKNPEDYAESSK
    IRHDFLEKQWEDK

    >gi|125625092|ref|YP_001033575.1| pyridine nucleotide-disulfide oxidoreductase [Lactococcus lactis subsp. cremoris MG1363]
    METRHFKNIIIGFGKAGRALAKSLSKNGEEALIIERDQAMYGGTCPNVGCAPSKTLIVAGQKNMNFSEAMTTKYKVREIL
    HNAAYHGVADEALVYVMDGLARFINSKTVEVVNGENVTQVIGERIFINTGATPIIPEIEGIHEAKNIVTSEGAMELSELP
    KKLVIIGAGYIGLEFAGMFNKFGSEVTILEPHATFLPKEDEDISNEIYKDLVAAGVEIQLGVEIERITDSEVFAGGKVYP
    ADKILIATGRRPNIKDLDLEKADVELSENGYIKVDDDLKTTAQNIWALGDVRGGGQFYYLSTDDFRIVNNQLFGDHSRKL
    SDRKLVPYSVFISPTLSRIGLDEKQAKEAGVNYRLFKMAAAPIVKAKVVQDTRGLLKALVDPNTDEILGATLYHEDSHEV
    INLVSLAMKMHTPYQVLRDQIFTHPTMGEGLNDLFQNEVK