Lactobacillus salivarius UCC118 uid58233

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56707117|ref|YP_163747.1| putative mercury(II) reductase [Lactobacillus salivarius UCC118]
    MRHFKNIIIGFGKAGKTLAGSLTSHGEEVLLIEKDPMMYGGTCINIACLPTKNLVINSQRGVKYEEAFETKEAMTAKLRN
    KNYHKVADQDLATVLDATAEFLDDKTIKVTDESGTEELTFDRLFINTGAESNVPNIDGLKIDDKIFTSTEMLAKKELAKN
    LVILGGGPIGLEFASMYAGFGSKVTVIEPMPSILGRFEPEIAQAAKADMEADGVTFMLKSSLTKVEETEAGLNLTVETED
    GVKDLQADVMLVSVGRHPATAALHLEKTSLEVGQRGEIVVNDKLETSVPNIYAMGDVAGSLQFTYISLDDWRIVDNQLFG
    DKTRTKKNRPVFANSIFIKPAISSAGLTESELKAQGKAYKVLTMPAAGVPKAQVIGNPRGAYKALIDPETHEILGATIYA
    EEAYETINVITLAMQNHLKAEDLRDQIYAHPTMTEALNDLFKF

    >gi|56707168|ref|YP_163798.1| pyridine nucleotide-disulphide oxidoreductase family protein [Lactobacillus salivarius UCC118]
    MDKFKNIIIGFGKAGKTLAKYLAQHDETVLLIERSKQMYGGTCINVGCLPSKNLILNGQRGLDFTTAVNKRGEMTRQLRD
    KNYHMVADEPLATVWNGSARFIDNYVLAVVMSDGTTKKVRGERIFINTGAVPNWPSIPGLEFGQRIFTSKEAMELKKQPK
    RLAIIGGGYIGLEFAGMFNSFGTHVTIFDQHTRLLEREDPDIATEVVTDLTDAGIEIKPETQLTQVKDNGEKVTLYYQQG
    DQTNTAEFDAVLVAVGRRPNISSLGLENTDIALTNRGAIQVDDHLRTTVQNIWALGDVNGGPMFTYVSLDDFRIIIDQLF
    GKGNRSTADRSVIPTASFLNPPLANVGLNERQAKSAGYNFQTFKLSVKAIPKARVLEDQRGLYKVIIDQNTHCILGATLY
    AAEAHETINLIALAIKAKLPYEKLRDMIYTHPTMSEALNDLFKTLVVKN

    >gi|56707176|ref|YP_163806.1| glutathione reductase [Lactobacillus salivarius UCC118]
    MTEQYDVVVIGGGPAGNAIASGLQAQGKSVLIVEADLWGGTCPNRGCDPKKILLSAVEAQQAAQHLQHQGLTGTPTIDWP
    ALMAHKRGYTDGINDGTLKGLQHQGITTLHGQAHFQNDGQLAVGDQVVSATDYVIATGQRPAILPITGQEYFKTSTDFLD
    LDEMPKRVTFVGGGYVGFELAAIANAAGADVHVIHHNDRPLKAFDADLVQDLMATMTADGVTFDLNTDLQAIEQTDDGLQ
    LTAPDFELTTDLVISSAGRIPNADQLGLENVGVTFNRHGIQVNDRLQTANPHIYAIGDVSDTPVPKLTPVAGYEARYLVQ
    QLTQPGAAITYPVIPTQVFAVPKLAQVGLSATDAADQPDKYRVNTLDMTKWFSYYRFGARQAQARVIIDQASGQVVGATL
    LSDVADEMINYLTLLIEKHVTLAQLQQLVLAYPTPASDLQYLY

    >gi|90961019|ref|YP_534935.1| methionine sulfoxide reductase B [Lactobacillus salivarius UCC118]
    MKETKEELRQRIGEEAYQVTQNAATERAFTGKYDEFFEDGIYVDVVSGEPLFSSKDKYNSGCGWPAFTQPINNRMVTNHE
    DNSFGMHRVEVRSRQAQSHLGHVFNDGPQDRGGLRY
    CINSAALQFIPVAELDEKGYGEYKKLFD

    >gi|90961121|ref|YP_535037.1| NADH peroxidase [Lactobacillus salivarius UCC118]
    MKVIVVGSSHGGYEAVEGLLKDYPDAEIQWYEQGDFLSFLSCGMQMFLEGKVDSADKVRYMTPEAIRERGVSLFEQTQVF
    ALHSADHEIEVKDLQTGEVRTENYDKLILSPGAVPMELDVPGKNLENVYYMRGHDWAVKLKEKVLDNNVKNVVVIGSGYI
    GIEAAEVFAKAGKSVEVLDMLPRPLATYLDKELTDVIEPELTQNNVHVHGDQLVQEYLGENAVTGVKTDKGEYSADLVVV
    AAGVKPNTAWLKDELAMYPNGMVKTDNFMRSSADDVFVVGDATLLKYNPGNTLLNVALATNARKQGRFAVKNLEAPLHPF
    PGVQGTSALSVFDYKFASSGLNATNAQKLGKQVRSVVVEDDFRMDFVPKEENAYVWFKLTYDPDTKAILGGQILSKHDLT
    AYINVISLAIKTKQTIYDLAYEDFFFQPGFDKPWNILNLAGLAAEKQEDED

    >gi|90961138|ref|YP_535054.1| dihydrolipoamide dehydrogenase [Lactobacillus salivarius UCC118]
    MVVGDFAIDLDTVVVGAGPGGYVAAIHAAELGQKVTVIEREYIGGVCLNVGCIPSKALIEAAHHYQHAMDSQEMGLQVTA
    AKLDFDKTIEWKNNVVARLTGGVASLFKKHKIDVIWGNAYLKDSHSLRVISDDDKAQTYTFNNLIIATGSHPIEIPNFKF
    EGRVLDSTGALNLTEVPKELVVVGGGYIGSELASAYANLGSHVTILEGGDMILANYEKDLVKVVEHHFSEQGVDIYTNAI
    AKNAEQTDKDVTVTFEVDGEEKKITADYVIVSVGRRPNTSNMGLEQAGVSVDERGLIPVDAQSRSNIPNIYAIGDVTKGY
    ALAHKASYEGKVAAEAISGKPTVIDYHAMPAVCYTDTSIATTGLTLAEAKEKGFDAKKAQFPFAANGRAISMGETDGFIR
    LVFEKETGVLLGAQMVGSNASDLISELTLAIECGSTVEDVALTIHPHPSLSEAVMDTADVAIGFPTNI

    >gi|90961459|ref|YP_535375.1| thioredoxin [Lactobacillus salivarius UCC118]
    MEQLAKMNKQELEEKLAKGKYVLFFTAGWCPDCRFIKPAMPEIEEEFSDFNFIQVDRDENIDLCQELDVYGIPSFIVYED
    GKEVDRFVNKDRKTKKEVENFLKAI

    >gi|90961535|ref|YP_535451.1| O6-methylguanine-DNA methyltransferase [Lactobacillus salivarius UCC118]
    MYKMNYDSPIGNIVLKSDGYSLVECYFSDEEENEEKNIGNVVLEETVQWLDDYFKGNKPLIKDLPIKFKGTEFQLKVWNE
    LLKIPYGSTISYKELGKIIFGEKNISSQAIGRAVSKNKLLVIVP
    CHRVIGSRGDLVGYAGGIDRKKYLLDHEK

    >gi|90961584|ref|YP_535500.1| arsenate reductase [Lactobacillus salivarius UCC118]
    MLKVYCYKKCSTCKKAIKWLDNHSIDYKYYEITEERPQEDLFKLWLQDTEKKATYFFNTSGNLYRTMNLKDKLKELSIEE
    KAKLLADNGMLIKRPLVIKDDGSVLCGFKEEKYKEFL

    >gi|90961669|ref|YP_535585.1| peptide methionine sulfoxide reductase [Lactobacillus salivarius UCC118]
    MSKDTAIFAGGCFWCMVEPFDKMPGIISVRSGYTGGFVENPTYEQVCSHTTGHTEAVKIVFDPEIISYAELVNIYWRQTD
    PTDAMGQFQDRGDSYRPVIFVHDEEQRKIAEESKKALAESGEFDKPIVTQIEDAKPFYEAEEYHQDFYKKNPERYALEEM
    GGREQFRNQHWN

    >gi|90962079|ref|YP_535995.1| thioredoxin [Lactobacillus salivarius UCC118]
    MVTELTDQTFDEKTNNGVTFTDFWATWCGPCRMQSPVIEQLAEEMGDKVFFSKVDVDANQETAAKFGIMSIPTMLIKKDG
    QVVDTIVGYHTKEQLQKKLEAYI

    >gi|90962205|ref|YP_536121.1| glutaredoxin [Lactobacillus salivarius UCC118]
    MKLDLFTKNNCIQCKMTKKFLKQHNVEFEEHNISENPEYIDYLKNKGFQAVPVLEENDSPIVNGFRPDLLKKLIAQ

    >gi|90962301|ref|YP_536217.1| pyridine nucleotide-disulphide oxidoreductase family protein [Lactobacillus salivarius UCC118]
    MQEFKNIIIGFGKGGKTLAKNLAAKGESVLVVEKSKKMYGGTCINIACLPSKNLIINAQRGIKFEDAVKQKDEMTTALRN
    KNYHMVADEETATVLDGTAKFVDNHTIEIVLDSGEKTKIKGERIFINTGATPIIPQVKGLKESKYILDSTAAMDQNSLPN
    ELVILGAGYIGMEFASMFARYGAKVTVLDTNEKFLKREDDDISEMIFNDLSQDGIEFNLGVKVVEVRDLSDKVEIVYEIN
    GQKRTVKADKLLVATGRKPVTEGLGLENTDIKLDERGAIKVDDYLRTTAENVWAIGDVKGGPQFTYISLDDFRIIFDQLY
    GKGERKVSDRKLVPYSVFTTPALSRVGLNEVEAKNKGIEYKLFKLAATSIPKAKVIGNTRGMYKILVNPDTEEILGATIY
    GEESYEVINLIALAMKAKLPYTMLRDQIYTHPTMSEALNDVLKG

    >gi|90962302|ref|YP_536218.1| arsenate reductase [Lactobacillus salivarius UCC118]
    MVTLYTSPSCTSCRKARAWLEEHNIPFEERNIFSNPLNVDEIKQILQMTEDGTEEIISKRSKIFQDLDIDLDELPLQKLY
    TLIQKNPGLLRRPIIMDSKRLQVGYNEDEIRRFLPRDVRALELQRAQALVDL

    >gi|90962446|ref|YP_536362.1| thioredoxin [Lactobacillus salivarius UCC118]
    MAKNITPKDLADVTKKGLTLVDFWAEWCGPCKMMNPVLEELEKDYQGKVKFAKVDVDKYQDLAMEYKIMSIPAMILFKDG
    VAKEKVVGFHPKKDMANYLDEKLAEVE

    >gi|90962655|ref|YP_536571.1| thioredoxin peroxidase [Lactobacillus salivarius UCC118]
    MKITRHDEPLSTNGTPVDVNGVFPEFTVQNAKGENVSSSDLLKKVTFISVVPDINTRVCSISTKKFNQDVDKYSNIAFYT
    VSTNTIEEQANWCAAEGVKNMQLLSDKAFDFGKNTGLYVADNDTDARSVWVLDNDGKVLYRELVIEQTNEPDYESVLQFL
    DSLA

    >gi|90962691|ref|YP_536607.1| thioredoxin reductase [Lactobacillus salivarius UCC118]
    MSDKYDVIVIGAGPGGMTAALYASRANLKVAMLDRGVYGGQMNNTAEVENYPGFKSILGPDLAEEMFQSSTQFGAEFVYG
    NVEDLTVDDNGIKHVKTDDGELEAPVVIIATGSQYRKLGVPGEEKYSGRGVSY
    CAVCDGAFYRDKPVGVIGGGDSAVEEG
    MYLAKLTSSVNVIHRRDELRAQKILQDRAFANDKMHFTWDTIVTEIVGDDKKVTGVKTHNKKTGEDGEIEANGVFIYVGS
    VPMSEPFQKLGITDDKGWIVTDDHMATSVPGIFAIGDVRSKFLRQITTAVGDAGIAGQEAFAYIESLKDKN

    >gi|90962756|ref|YP_536671.1| hypothetical protein LSL_1784 [Lactobacillus salivarius UCC118]
    MEKAILQLETLSCPSCMQKIEGALKSVNGIDKDSIKVLFNSSKVKINFDSAVTSIEEIQKAIENVGYPVLKAKVKAA

    >gi|90962822|ref|YP_536737.1| hypothetical protein LSL_1848 [Lactobacillus salivarius UCC118]
    MIHAVLYTKPKCVQCKMTRRKMTALNFPYVDNYYGDCHEDNSIDVESSDEKKRNWSIEKIEKLKQKYHIKSLPFIKIVDD
    DNKVLDSWVGFRPDKISEWCLKIK

    >gi|90962829|ref|YP_536744.1| putative thioredoxin-like protein [Lactobacillus salivarius UCC118]
    MSEEEKKRYRNRKIVTVIVMGISVLIFGLIGLLQLNSLKRTPTSERTEAINSNIPTIVMFYSKTCPDCKRVIGTVKLARF
    KSYGNPTRQDYGVAFVEVNTPDDKDLVNQYHITKTPTFMIFKNGQPQAIGSANGFDVFQYAGTDKEQIKSLYTNLVLKQG
    GDSQ