Lactobacillus sakei 23K uid58281

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|81427717|ref|YP_394715.1| Thiol peroxidase (hydroperoxide reductase, peroxiredoxin) [Lactobacillus sakei subsp. sakei 23K]
    MQITRHDQPLETIGTPPKVGEQLPAFELVDADHQTRTTQQLLGKRTLISIVPDINTRVCSIQTKHFNQAIDQFTDINFYT
    VSTNTVEQQQAWCAAEGVQLMQLLSDEALSFGKALNLYVPSNNTLQRSIMIVEADGTISYEELIVEQTDEPNYAAALEFL
    KSAH

    >gi|81427828|ref|YP_394827.1| thiosulfate sulfurtransferase [Lactobacillus sakei subsp. sakei 23K]
    MEEQILQYRDAVYEQVVKVGKSLGNVTRLRILDLLVQGPKTVENLANTIGLSVATTSRNLQILKKARLVEIERHKNFVTY
    RLTSDQIKQLISLLVTVAEQSQPELAAIQTTFKQQTGSPQALTISALKAKLTAESTYLVDLRPNDEYETQHLPGAHNIPY
    DELPQHLAELPQDKEIVVY
    CRGRLCAYANVASQALHDAGFKVATFNQSVWEWNQLMSS

    >gi|81427829|ref|YP_394828.1| thioredoxin [Lactobacillus sakei subsp. sakei 23K]
    MTAQILNEANFNDEIKEGVTLVDFWATWCPPCKMQGPIVEQLADDYAGKAKIAKVDVDQNQNLAAQFGIQAIPTLLIMKD
    GQLQEQLVGLQRKEALATKLDATLA

    >gi|81427922|ref|YP_394921.1| thioredoxin [Lactobacillus sakei subsp. sakei 23K]
    MTQTITANNIEAFVAEKPLVILDFWADWCMPCKIMTPMIQELHAASNDAFKLGMVDVEDQPELAERYDIQSVPTLLIFKK
    GKAAEKVTGAFPKEKLKRYLDKKIAESNHEG

    >gi|81427927|ref|YP_394926.1| coenzyme A disulfide reductase [Lactobacillus sakei subsp. sakei 23K]
    MRTIIVGATAAGTSAAAKAKRMNPELEVVMYEMRDYVSFGACGLPYFVGEHFDNPNQMIARTPEAFAKQGIDVQLEHEVV
    AVDFDTQMVTVRDLKTKQAKTEHYDQLMLATGATAVMPPFENGQLDNIYHLRTLADGEVLRQLGQTPEIQSVTVIGAGFI
    GLEIAEEFHQLGKKVRVIQLEDRVLPLAFDPELTAMMAADLRDNGIELRLSEAVQSFEGQSKVTGVVTDKGRYETDLVVV
    AAGIRPNTQFITDDRLKKLKNGAIVVDQTGRTSIENVFAAGDNATVINSVTGEPMYSALATGANKLGRVVGVNLAGRQAQ
    LPGMLNSAGVKLVTLEAGRTGLTSAEAQAAGIDYDTVLIHDKNHTDYYPGQSELTIKLVYKKADHVLIGGQIIGQKDAVL
    RVDVLATAIQAQMTTEQLGLLDLVYAPPFARTWDALNVAGNVAH

    >gi|81428008|ref|YP_395007.1| thioredoxin [Lactobacillus sakei subsp. sakei 23K]
    MVDVLTDKDFEAETSQGVVLTDFWATWCGPCRMQSPVIEELAQTNDKVKFTKMDVDANPDTPAKFGIMAIPTLLVKKDGQ
    VVETITGFHNKEQLTETLAKYTD

    >gi|81428039|ref|YP_395038.1| putative heavy metal-transporting P-type ATPase [Lactobacillus sakei subsp. sakei 23K]
    MTQIQLAGIDCAACATKIETNVKKLPQVQDCAVNFATQKLSYELTGDQAATAFELALQQLLTTIEPDVTIQKSLPAAGQT
    PPKKFKFNLDLIRIIISGLLLLGSYVLPLSQPLLISLLLVAFVLIGYDIIWTAIRNILHGQWFDENFLMTVATIGAFGIG
    EYAEAVGVMLFYQVGEYFQSLAINRSRDSIASLVAIKPTFANLQTSQGLQQVAPEAVPVGATILIKPGEKVPLDGTVIAG
    SSFVDTAAVTGESVPRSFNVGDTLLSGSINQSGLLTLQVTKPYANSTVAKILDLVENASSQKAPTENFITRFAKIYTPIV
    VGFAVLLAVVPPLFLGQPFSDWLYRALIFLVISCPCALVISIPLGFFAGIGTASKNGILVKGSNYLEALNDVRTVVFDKT
    GTLTQGSFTVTAIHAVDHQPEHLLALAALAEQHSTHPIAQSIIAANQAPLNQTLSAVTEVAGHGVSATLDGQSLKVGKAS
    WLKEQGLTPLTPTEVGTAVHIAYGTDYLGYLVISDQLKKDAATAIAQLKKVGIRQTMMLTGDNDAIAKQVSQSLGIDHYQ
    SELLPQDKVATLASLTDNRAQNGKVAFVGDGINDTPVLARADVGVAMGGLGSDAAIEAADIVLMSDEPTKLATAIDIARF
    TRKIVWQNIAFALIVKAIFLLLGAFGIATMWEAVFADVGVTLIAILNALRIMRKSN

    >gi|81428133|ref|YP_395132.1| thioredoxin reductase [Lactobacillus sakei subsp. sakei 23K]
    MAKSYDVIVIGAGPGGMTAALYASRSNLSVLMLDRGIYGGQMNNTAEVENYPGFKSILGPELGEKMYASATQFGAEYGYG
    TVNSIEDKGEFKLVHTDEGDFQARAVIIATGSEHKKVGIPGEDEYGGRGVSY
    CAVCDGAFFKNKEVVVIGGGDSAIEEGL
    YLTQLASKVTVIHRRDQLRAQKILQDRAFVNDKMAFVWNAQVKTIEGDDKKVAAVTYVDKESGETKGVPASGVFIYVGID
    PMTSAFKDLGILTEAGWVKTDDHMATSVPGIFAIGDVREKDLRQITTAVGDGGIAGQEVFKYIQSI

    >gi|81428164|ref|YP_395164.1| organic hydroperoxide resistance protein [Lactobacillus sakei subsp. sakei 23K]
    MAKQYETTMINEGGRNGFVYDPEKSTKYVIKAPGTDKTGKSTNPEQLFAAGYSSCFNSALELVLSQDQIKAETTVKATVS
    LYNDGPADFYIGVELVGHIEGLSPEDTKRYLEKAHEV
    CPYSKATRGNIDVKIDVM

    >gi|81428190|ref|YP_395190.1| NADH peroxidase [Lactobacillus sakei subsp. sakei 23K]
    MKIIVVGSSHGGFETVQESLLDYPDATIQWYEQGDFLSFLSCGMQLYLEGTVKNVDDVSYATPEGMRAKGVDVRLQQAIT
    AINADQHTVQVKDLKNNTTREESYDKLVLSVGAVPFELPVAGRDLANVYAMRGRDWAIKLKAKTVDPTVKNVVVIGSGYI
    GIEAAEVFAKAGKNVTVVDVLPRLLSLYLDQEFTDELTTEMQAHNIYPAVGQSVKEYRGADGKVTKVVTDQAEYDADLVI
    EAAGIRPNTAWLKDVLDLDRSGRIKINEYLQTSQPDIFAVGDATVVKYAPTGEEIPIALATNARRQGRYAAKNLVTADQP
    VPAVSGSSALSVFDYHFASTGIKEGTADKSGVKTQSVVVTETYRPHFVPADENPEVKFKLTFDPETGRILGAQIMSKADV
    TANINAISLAIQGKMTVDDLAYADFFFQPGFDRPWNIMNVAAQKAQRLMH

    >gi|81428249|ref|YP_395249.1| thioredoxin [Lactobacillus sakei subsp. sakei 23K]
    MKEFAKMAETNLTHLITKGKHVLFFTATWCSDCRFIKPAMPEIEAEFPEYEFIEIDRDQYIDICEEWEIFGIPSFVVIDN
    GREVGRFVNKDRKTKREISEFIHSLS

    >gi|81428415|ref|YP_395415.1| NADH oxidase [Lactobacillus sakei subsp. sakei 23K]
    MKVAVIGCTHAGTFATQATLTAHPDWDVTVYETHDNLSFLSCGIALWVGGHVSDPKKMFYSSPEMLAQLGAHMKMQHTVL
    KADLKEKVLHVKNLVTSEETIEKFDKIIVTTGSSPVIPPIEGIDNPNVKL
    CKNWEHANELKKSAPDVKSVIVIGSGYIGA
    ELAEAYATTDKKVTLIDALPHALGKNFDPNISEIVEQDYRDHGVQLALSEKVVSFSGTDQVTVKTDKNEYTADLAILCVG
    FRPNTGLFKDQVEMLGNGAITTDEYMQTSVKGVYAAGDSAAVYYNPTQKADYIPLATNAVRQGLLIGRNIETPTEKYMGT
    QATSAVELFGRTYSGSGLTVEGAKVRGMAVATTTLTEDYRPDFMPSTTPVLMNLTWNPKTRQVLGGSFTSQYDIAQAANV
    ISMAIQTKMTIDQLAMVDMFFQPNYDQPLNYVNAIAMKAVAESH

    >gi|81428475|ref|YP_395475.1| putative methionine sulfoxide reductase [Lactobacillus sakei subsp. sakei 23K]
    MSDDLRQQLTPEQYVVTQENATEMPFSGEYDEFDQPGIYVDVVSHEPLFSSLDKYDAGCGWPSFTRPIVKLNEKRDRTHG
    MERVEVRSQNADSHLGHVFTDGPQEQGGLRY
    CINSAALKFIPKDDLKAAGYGEYLALFEKEGQ

    >gi|81428476|ref|YP_395476.1| protein methionine sulfoxide reductase [Lactobacillus sakei subsp. sakei 23K]
    MATETAIFAGGCFWCMVHPFDQQPGILKVVSGYTGGHVANPTYEQVCSHTTGHTEAVEITFDPAVISYAELVEIYWRQTD
    PTDAMGQFQDRGDSYRPVIFVNSDQQRSIAEASKEKLIASGRFNEPIVTQIEAAKPFYPAEDYHQDFYKKEPWRAELGEV
    KRKAFIREKWSD

    >gi|81428553|ref|YP_395553.1| ribonucleotide reductase, NrdH-redoxin [Lactobacillus sakei subsp. sakei 23K]
    MANITLYTKNGCPQCRMTKHFLETHNITFSEHNINDEPQYIDYLKEKGFQAVPVLEADGVESFSGFRPAELQKLAF

    >gi|81428692|ref|YP_395692.1| dihydrolipoamide dehydrogenase [Lactobacillus sakei subsp. sakei 23K]
    MVVGDFAIELETVVIGSGPGGYVAAIRAAEMGQKVTVIERENIGGICLNVGCIPSKALISAGHRLQEAKNSEVFGVSTTG
    ATLDFAKTQDWKQHQVVEKLTGGISMLFKKHKIDVLDGSAFLVDEHSLRVIKEESAQTYSFKNLIIATGSRPIEIKGFKF
    NKRVIDSTGGLNLTEVPKELVVIGGGYIGSELAGAYANLGAHVTILEGTDSILPNFEKDMVQLVTKNFKTKGVDVITGAM
    AKESIETDQNVTVKYEVGGKEEQLVADYVMVTVGRRPNTDDMGLEQAGIKMADRGLIEVDQQGQTNIKGIYAIGDIVSGA
    ALAHKASYEAKIAAEAIAGKKVIVDYKAMPAVCYTDPELATTGLTVAEAKEKGYNAKGFKFPFAANGRALSLAETDGFVR
    LVTNTDDNTLLGAQVAGVGASDLISELTLAIESGMNAEDLALTIHPHPTLSEAIMDDAELALGLPIHI

    >gi|81429037|ref|YP_396037.1| putative copper-transporting P-type ATPase [Lactobacillus sakei subsp. sakei 23K]
    MTTKTFNIDGMVCASCAQTIEGATQKLPGMQKAAVNLATEKMQVEYDDSELSVTAIEDAVSAAGYGATEQIDPEKEAQAI
    QAKRTAHLQALWRRFWLSALVTLPLLYLSMGHMVGLSLPTFWQPMQAPINFAVTQLVLTLPVLYWGRQFFIVGFKALFNG
    HPNMDSLVALGTSAAWGYSLIATLAIISGHVALVTSLYYESASVILTLITLGKYFEARSKGQTSSAIEKLLNLAPKQATV
    LREGVETTIDVAEVVVGDVLVVRPGEKVPVDGEVIAGHSAVDESLITGESLPVEKQVGDAVIGASLNKNGHFQFKATKIG
    KDTALAQIVQLVEQAQGTKAPIARLADKIAGVFVPIVIGLALLSGLAWFFLGQESWLFALTITISVLVIACPCALGLATP
    TAIMVGTGKGAENGVLIKSGDALETAQHIQTVVLDKTGTITAGQPIVTDMVVYQGTEDDLLQLAASVEAGSEHPLASAIS
    QAASERQLTLSAMTDFTAIPGYGLSAQVADQTILFGNQQLMAKNGVAIEVGLKTAQQLAEQGKTPMYLAQDGQLQGVIAV
    ADPVKATSQAAISRLQKMGIQVVMLTGDNQKTAQAIAHQVGIEQVISDVLPEQKAAQIKTLQATGQLVAMVGDGINDAPA
    LAQADVGLAIGSGTDVAIESADIVLMHDDLMAVPTAFKLSRKTMQNIKENLFWAFAYNILGIPVAMGVLHLFGGPLLNPM
    IAGAAMSFSSVSVLLNALRLKQLKLA

    >gi|81429058|ref|YP_396058.1| transcriptional regulator Spx [Lactobacillus sakei subsp. sakei 23K]
    MVTLYTSPSCTSCRKARAWLKEHNIPFKERNIFSEPLNKNEIKTILRMTEDGTEEIISTRSKIFQQLNIKIDDLSVNELL
    DLVQENPGLLRRPIILDEKRLQVGYNEDEIRRFLPREVRALELQQAQLMAGF

    >gi|81429388|ref|YP_396389.1| putative 4-carboxymuconolactone decarboxylase [Lactobacillus sakei subsp. sakei 23K]
    MTYSEQAQTGKKEYAALKEASPEVMGAFGDLHKANVKDGALTVKEKELIALGIAIATRCEGCILSHMNRLIKEGVSRDEV
    IETINTAVMMSGGPGTVYGGKALAYFDERQ

    >gi|81429395|ref|YP_396396.1| putative heavy metal-chaperone/transport protein [Lactobacillus sakei subsp. sakei 23K]
    MAKLVMQLDELSCPSCMQKIQAGVSQQAGVESVKVLFNASKVKTEYDETTTNPEQLTQVVTDLGYNVKSVKVK

    >gi|81429454|ref|YP_396455.1| methylated-DNA-protein-cysteineS-methyltransferase [Lactobacillus sakei subsp. sakei 23K]
    MTTIYYDYLMQDDQKIIVAATDHGICFVGSPNQPLSELTTFMPNHDLLQDPAKLAPVIDQITAYLTHARTTWDLPLDFLV
    GTPFQQQVWTVLQTIPYGQTVTYNQLATQIGRPTAIRAVASAVGRNPLLMIVP
    CHRVIRKDGSLGGYRGGLPFKKQLLAL
    EQ

    >gi|81429481|ref|YP_396482.1| glutathione reductase [Lactobacillus sakei subsp. sakei 23K]
    MKTHFDTIVIGGGPGGLAAAYRLAEQQSVLVVENDLWGGTCPNRGCDPKKMLYSAVEAIDHQHTLQSSGLVGTSYINWPQ
    LMAFKRQYTTQIPDGTLNGLQSAGIRTVTGTAHFIADHHLRVGETDYTADHFIIATGQTPTLPAIEGRDLLQTSNQFLDL
    DHLPAKIAFIGAGYIAIELANIAATAGAEVHIIQHNKRILRDFPEAMTTELITSLQNKGVQFHFETTVTKVYETTKGLVL
    NNAGGFTLTVDAAFAALGRHANIDELNLPAADIATGHHGIQVDEHLVSSNPRVYAIGDVVDRPQPKLTPVAGFEGRYVAN
    QLLQTNSDPIAYPLIPHTVYASPQISQAGVSVQTAQENPDQYRLNQQTTTNWYTFNRIKEPNAIVTTIFDRQTNQLVGAA
    AYTTIAEELINYLTPLIKNHTTAAELTDTIYNYPSPASDLKYYY