Anaeromyxobacter dehalogenans 2CP C uid58135

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|86156528|ref|YP_463313.1| methylated-DNA--protein-cysteine methyltransferase [Anaeromyxobacter dehalogenans 2CP-C]
    MSARLRYRSPVGVLTVEASDEGVFGLSFGDRGPSHPGPSARARGHLDAAARALDDYFAGRPPSLPPLVLQGSPFQKRVWE
    ALLAIPWGDTRTYGEVAEALGAAGGARAVGGANHENPVAILVP
    CHRVVQARGRLGGYGGGVEVKRWLLAHEAAHGPALRP
    A

    >gi|86156741|ref|YP_463526.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-C]
    MLTVGDRFPEFSLQAVTSLESGNEFETITQASHPGKWKVVFLWPMDFTFICPTEIAEFGRRNGEFQDRDTQVLGASIDTH
    YVHLAWRKSHPDLKNLPFPMLADTRRELSGALGVLHRDGVALRATFIVDPEGVIRHVSVNDLSVGRNVDEVLRTLDALQT
    DELCPCNWKKGESTLQVA

    >gi|86156753|ref|YP_463538.1| methionine-S-oxide reductase [Anaeromyxobacter dehalogenans 2CP-C]
    MGRSTAREARMDKLILSDAEWRDRLTPEQYQVLRGHGTEPPGTGCFLGTHEPGTYVCAGCGNPLFRSGEKFESGTGWPSF
    TRPVSEEAVVEVHDRSYGMRRTEVRCARCDGHLGHVFPDGPPPTGLRY
    CMNSAAMQHVPEGAPLDAPGGG

    >gi|86156768|ref|YP_463553.1| hypothetical protein Adeh_0340 [Anaeromyxobacter dehalogenans 2CP-C]
    MTPPTPAARRTSGRPRAGARRAPLLVAAVVLGVATLVIADRTLGGSGAPRTDAPAPPLRVGAVSGGGEIDLARLRGRAVV
    VNFWAPW
    CAPCQAELPDLAAVKQDLAGRCVELVGIAGDGTRTEVAQVAARQPYPIGFDERGDAMRAWRVESVPTTYLVDA
    DGKVRTVIPGAVGREELLEALRPIIPATCPAG

    >gi|86156864|ref|YP_463649.1| rhodanese-like protein [Anaeromyxobacter dehalogenans 2CP-C]
    MKLPWWFPFGSVPELSAVELNDRLRGRPAPQLVDVRTPAEFSQGRIRGAVNVPIGELRGRLATLKLDPARPVVAVCLSGH
    RSVPAVRLLERGGFEAAQLAGGMLAWRGARLPEVKG

    >gi|86156871|ref|YP_463656.1| OsmC-like protein [Anaeromyxobacter dehalogenans 2CP-C]
    MTQHVKAAIEGLAAAVTAEPHRARATFRATTISEGAGLATRSVVRGFEVPLDEPRELGGTDTGPNPVEAVLAALGSCQAI
    VYRALAAAQGLQLERVEVVATGVLDVRGFLGAAPVSPGFERVTFRTRLTSPEPLERLRALARQVEAQ
    CPVLDVLQRPLDV
    RGELELVSIPAAGRAA

    >gi|86156933|ref|YP_463718.1| vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-C]
    MGHAGRQDGRATSGYHPPVPAPHVPDTSRGKQPDRGGTSARSRALELAILLLALAGAGLAAELTLLHGRAHAGGASSFCA
    ISERVNCDKVALSAWSSLLGVPLAAWGLLAYLVIAALAASALRRPRAEAGWPAGLLLAASGFMAAGAVFLAAISELVIGS
    LCIVCAGSWLVSFALAGCAFVLARRAGGPAAAIRADLAALRARPLASASAALVLLAASGGLFAFYAGPPPAGTGTGAPAA
    AAPAAKLGPPGSIVLYEYSDYE
    CPFCAKSHEANKPILASRPDVKVVRRHFPLDDTCNPKLTRPFHVGACDLARAAICAEA
    QGRFEQMDDALFRNQAEKAPVRELARRVGLDLPRFDACLSSPDTERRLADDIESAIQAGVRGTPSYVYGGKVYPGDLATL
    LGAKPATTSGG

    >gi|86157019|ref|YP_463804.1| cytochrome c biogenesis protein, transmembrane region/thioredoxin-related [Anaeromyxobacter dehalogenans 2CP-C]
    MRFAIRILLAALTFAAVAWIPDLIGLGPAGGSSDLRLGALLAEGSILAFAVAFAGGVATSLTPCVYPLIPITVSIFGARK
    AGSRGEAMAVSALYVLGIAAMYSALGVGAALTGKAFGSVMQNPWVIGFVAIVLAAMAASMFGAFELQLPPSLQARLNGVG
    GAGRAGAFAMGLVSGIIAAPCTGPVLAAALTFVAAKGSVAFGFGIMFAYALGMGLLFFLIGAFSISLPKSGAWMETVKSV
    FGVALLAAALIFLKDAFPALKPLFSAARGAAFAAAGAAALGVLAGALSGSFHAPARQRLAKGLGVALLVGGIAYAAGAAG
    ARERARAHAGFAWIHSEEEALALAKAEGRPVIIDFWADW
    CTACKELDKIAWAKPEVQEEAARFVAVKLDGTDGSDAFNAL
    AEKYGVVGMPTVIFIDPRGREVPDRVMGAISAGEMVQKLRAVDGACEGKPPPATPAAVQGEQVAMACAARW

    >gi|86157022|ref|YP_463807.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
    MAAAIEISEKAAVHIKALGAQKGAPAGGLRLGVKGGGCSGLSYFIDWANEPARFDQVIERDGARVFVDPKSAVFLAGTVI
    DWQQTLMQTGFVFRNPNVKSACGCGESFTI

    >gi|86157255|ref|YP_464040.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Anaeromyxobacter dehalogenans 2CP-C]
    MTDSEPSTRARRVRHHQETDMAQVTLKGNPIHTNGELPAVGAKAPDFTLTTGDLKDVTLAEWKGKRKILNIVPSLDTAVC
    ATSTRKFNENAGKLANTVVLVVSADLPFAQKRFCTTEGLQNVVPLSLIRGKHMAKDYGVLLQDGPLAGLTARAVVVLDEA
    DKVVYRQLVPEIGQEPDYDAALAAAKQ

    >gi|86157370|ref|YP_464155.1| hypothetical protein Adeh_0943 [Anaeromyxobacter dehalogenans 2CP-C]
    MLEPLPGAAPFPDALARQLAEAVRAGAAAGHGGAAPRFTNRLALERSPYLLQHAHNPVSWWAWGDEAFEEARRTGRPVFL
    SVGYST
    CHWCHVMERESFEDEEIARVLNERYVAIKVDREERPDVDAVYMTAVQLLTGSGGWPMSVWLTPDREPFFGGTYF
    PPRDGVRGPARGLLSILHEIADLWARDPDRIRSATGALVEAVRTALAPAGPAAADVPGPEPIEHAVTLLERSFDERHGGL
    RRAPKFPSNVPVRLLLRHHRRTGEERSLRMATVTLERMAAGGLHDQVGGGFHRYSTDAQWLVPHFEKMLYDNALLAVAYA
    EAWQATGRRDFARVTRQTLDYLLRELTSPEGGLYSATDADSEGEEGRFFTWTEAELREALGDRAEAFLRFHGVRPEGNFE
    GRNVLHVPAPDEDAWESFAPDRAALYALRERRPRPLRDEKVLAGWNGLAISALALGGRVLSEARWVDAAARAADFVLTRM
    VKDGRLQRSWLAGRAGVPAYLEDHAFLVQGLLDLHEASFDPRWLRSALQLAEAQDRLFGDPAGGGWFQSATDHERLLARE
    KPTHDGAEPSGASVAALNALRLEAFTSDPRWRRAADGALRHHARTLAEQPLAMSELLLALDFASDAVREVVLVWPEGGDP
    GPFVDVLRRTFLPSRALTGAPEGEGLARLGAVAAIAAGKAAAGGRATAYVCERGACRLPAIAPEKLAAQVAPVRPYRA

    >gi|86157396|ref|YP_464181.1| methylated-DNA--protein-cysteine methyltransferase [Anaeromyxobacter dehalogenans 2CP-C]
    MTLEHVVVESPVGPVHLVSDGRALCALELGDGPHLRAALARRFGPDLALRAGRDPLGLAARARAWFAGDLGALDGLPLEP
    GGTPFQRLVWAELRRIPAGETRSYGALAAALGRPGAARAVGLANGRNPIAIAIP
    CHRVIGADGSLTGYAGGLERKRWLLA
    HERAARAQDPGAVGGENRAAMARATVRQSARTT

    >gi|86157452|ref|YP_464237.1| thioredoxin-related [Anaeromyxobacter dehalogenans 2CP-C]
    MRTKNWLKGILLVAALSAPVWAAAADAAPAGSRAGGKALPRLVDLGAGACVPCKAMAPILEGLRAEYAGRMDVVFIDVWK
    DRAAAEAHGVRMIPTQIFYGADGKELARHEGFIDRAGILARWKALGVRL

    >gi|86157455|ref|YP_464240.1| redox-active disulfide protein 2 [Anaeromyxobacter dehalogenans 2CP-C]
    MKIQVLGTGCAKCKQLTANAEQAVAALGLDAKVEKVEDLREIMKLGVMTTPALVVDGVVKSAGKVLSPDAVRALLGS

    >gi|86157572|ref|YP_464357.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-C]
    MARILDRAPEFKLRAVRGRGEPVEVSLSGLAGRWGVLLFYPRDFTTVCPTEVLELSKRMPELRALGAEAIGISVDDLDTH
    RRWIEEKLGDVAFPLAADPDRAVSRAYGALLEREGVAARATFVVDPEGVVQYAAFHNLRVGRSISEIVRVLEALETGEKA
    PAEWRPGAPTLGR

    >gi|86157603|ref|YP_464388.1| copper-translocating P-type ATPase [Anaeromyxobacter dehalogenans 2CP-C]
    MRCDHCLLEFPEREAVRAEVAGAPRVFCCAGCRGVFELIQGEGLGAYYDSRRWTEVGPQAAGALDLAAFREAVREAHGAA
    ELDVAIDGIR
    CASCVWLNEKLLQRTPGVLTARVNYATHRARIRFDPAAVGLERVLGRIQAAGYQPKPWSDAEQLQARRAE
    AKDLLVRLGTALFLASQLMIYQAALYAGYFQGIDAPTRRLMEWISLGLTLPVVFYSGAPFLRATGRGLRHLRFNMDSLVV
    IGSLSALAYSVYGMLRGGEVYFDTAAMIPTLVLVGRYVEAAAKGRASEAVARLASLAPREARRLEPGPGGRAERRAVAVA
    EIRPGDRIEVVPGERIPLDGVVREGASEVDESLVTGESRPVAKSAGAAVIGGTVNQHGALVVEVTRVGKDTVLAGIVRAV
    EEAQAQKPRIQAVADRVVGGFVPAMLVLAALTVVAWLARGAPVERALMTGISVVVIACPCALGLATPIAVLISTGLASAR
    GLLVKGGDVVERAGRATDVLLDKTGTVTRGRPALRALVPLEPGVGADEALALAAAVERRSEHHVGRAVAEAARALPAGAE
    PEAAGFRAVPGRGVVAEVGGAEVLVGNRTLLAERGVSLAPEADARARELEASGDTVAFLARGGRPLALVAVADPIREEAP
    AAIAALRGLGLRVAIVSGDGRITTGAVAAALGVEAVAEASPVQKREAVAARQREGRRVLFAGDGINDAPALTQAEVGAAM
    GRGTDVTMESADAVLVRDDLRLLPDLVRLSRRTYAVIRQNVFWAFFYNAVAIPLAMAGLLHPIVAAGAMAASSLFVVANS
    ARLRRAL

    >gi|86157963|ref|YP_464748.1| UBA/THIF-type NAD/FAD binding fold, MoeZ/MoeB [Anaeromyxobacter dehalogenans 2CP-C]
    MTSLSGKRVLVIGAGGLGGPALLTLAAAGVGQLVLVEDDAVETSNLNRQPLFQEADVGRRKAAAAAERLRAIFPSVAVDV
    RDERFDAGNAEALAAAADVVVDGSDNFETKFLANDAATRVRRPLVHAGVLRTTVQLLTVAPSGLGGCLRCLFEAPPPPGS
    VAS
    CSQAGILGPVAGFAGALLAAEALRLLAGERGTYEGRLFTYELRTGRSRLVLVRKRPGCLACAGRQVLGSSAPAACDA
    PAAPAGSPA

    >gi|86157982|ref|YP_464767.1| glutaredoxin [Anaeromyxobacter dehalogenans 2CP-C]
    MADAVEIYGKDACPYTAAARREYAARGLEVRYFDVKRDRAAMARFLELSGGDRRVPLIVERGRVSSGFGGS

    >gi|86158033|ref|YP_464818.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
    MAHATVEITSQNFKDVVEKDGIVLIDWWAPWCGPCRSFAPTYEKVAGKHPDIAFAKVNTEEQQELAAAFDIRSIPTLMIL
    RDKVLLFSQAGALPEAALEDLIRQVRALDMDKVRADVAAQEAEAAKRTASA

    >gi|86158173|ref|YP_464958.1| hypothetical protein Adeh_1748 [Anaeromyxobacter dehalogenans 2CP-C]
    MEIAMRATPAADEAIDGRTPAAAGAAPFLATHGAVEARPGGGNLRFRATHRWDQDARDPSDPALPPGGDGPMPEGLDLLP
    HAIAA
    CITAGMASIAAARGGEPVGGVRTMVGEIDLRGVISVQAGG

    >gi|86158246|ref|YP_465031.1| dihydrolipoamide dehydrogenase [Anaeromyxobacter dehalogenans 2CP-C]
    MPTQTYDAIVIGAGTGGYPAAIRLAQLGKKVALVEKDATLGGVCLNWGCIPSKALIAAANLVDEMRGAADRGIIAEPPRV
    DVAKLREFKDGVVKKLTGGVALLEKGNGVEVVRGTATVVGPTAVEVAGKDGQKTRLEAGAILVATGARPIEIPGFAFDGK
    DVWSAREAVDLPEVPKRLVCIGGGIIGMELGTVYAKLGAEVTFLEALPQVLTGVDPDAVRLVQKGLRQRGVAVHVNAKAK
    GYERRGKDLVVKVEIDGKEQEIACDKILVAVGFKPSSAGFGLEQVGVKIGPKGFIEVDPQYRTSVPTIFAAGDVTGPPLL
    AHKASKEGEIAAEVIAGHKTVRDWVGMPTAIFTDPEVAAVGLSEEEARKQGYDPIVGKFAFGALGRAIAIHHTEGFVKVV
    GDRKTKLLLGASICGPEAGDLIAEAALALEMGAYLEDVALTIHAHPTLPEAFNEACRAALGEAIHMLNRPERPRKGEAGA
    GARA

    >gi|86158284|ref|YP_465069.1| cytochrome c biogenesis protein, thiol-disulfide interchange protein [Anaeromyxobacter dehalogenans 2CP-C]
    MNGRLKLVLVALLAVVAFQVFFRGRNEPRSQGGGHPAPPLALPDLAGRTVDLGSLRGKVVAVNFWASWCGPCRAEIPDLA
    EVWKAHQGKCFELLGVAEESGREDVLAMARDIPYPILFDARATALEPWGVPAYPRTYLVDAQGTVQHVFAGSLDRETLTA
    ALQPLLPASCPKG

    >gi|86158315|ref|YP_465100.1| peptide methionine sulfoxide reductase [Anaeromyxobacter dehalogenans 2CP-C]
    MFAKKPSLPAAGEALPGRAEPMPVPEQHFVSGNRIVPPFPEGLEFADFGLGCFWGAERVFWKLPGVYATAVGYAGGVTPN
    PTYREVCTGRTGHAEVVRVVFDPAKISYADLLKVFWESHDPTQGMRQGNDVGTQYRSAVYTHGEAQRRLAEASREAYRAA
    LAARGGGAITTELRDAPPFYYAEEYHQQYLAKNPEGYCGIGGTGVTCPAFAAR

    >gi|86158441|ref|YP_465226.1| glutaredoxin GrxC [Anaeromyxobacter dehalogenans 2CP-C]
    MSAPKITVYTKQNCPYCVRAKRLLEKKGVAFEEISVEGRDELRTWLSEKTGQLTVPQIFAGERSLGGFSDLDALEQRGEL
    DPILRGE

    >gi|86158623|ref|YP_465408.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
    MAAVMEIGDAEFEREVLAAPEPVLVEFTAAWCAPCKALAPTLEALASGYRGRVKVAALDVERHPATAERYGIRSMPTLLF
    FMGGKVARQLVGAVPRARLEDAVRELLPG

    >gi|86158628|ref|YP_465413.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
    MASDLDVLVLGSGQAGVPLAARLAAAGRRVALVERGALGGTCVNAGCTPTKTLLASARAAHVARTAGRLGIRAGEVAVDL
    GAVMDRKDAVVARWRDGVRRRLEGAAPRLRVVQGAARFVGPREVEAGGERLAAPVVVVNVGARPAVPPVPGLDRVPFLTS
    SSALALRALPAHLVVLGGGYVGCELGQLFRRLGADVTVIDPSPHLLAREDEAVSAALEEVFRREGVRLALGAPAEAVEGG
    AGAVRVRLAGGGVVEGSHLLVATGRRPNTDDLGCDAAGVALDRRGFVEVDARYRTSAEGVYAVGDAAGGPQFTHSAWDDH
    RILFDLLLGRGRRTRDDRLVPHVVFTDPQVGVVGLTEREARARGVPFELATLPYSAVARAVEVDEPDGVVRVLVDPRDER
    ILGAAVVGAEGGELVHVLAALMQAGASARALVDMEVAHPTFCEGLQSAVMTLERFALRP

    >gi|86158676|ref|YP_465461.1| OsmC-like protein [Anaeromyxobacter dehalogenans 2CP-C]
    MQTTTTTPPAAKPARKPVPLNGVDTPTLFATLDAVRGQPDLAHFRFRATNHWQQGTHSRTRIEGFRGAGAERMHEREFTF
    DADHPAVLVGRDQGPTPVEFLLHALAA
    CITAGIGNIAAARGVTLYEVESTLEGDIDLNGILGLSREARNGYREIRATFRV
    KGDAPPEKLAEIVAQSQARSAVFDVLAHGVPVSIMVDAG

    >gi|86158918|ref|YP_465703.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
    MASNDVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTL
    LVFKGGRVVDTVIGADKTRLEDSVKKAIG

    >gi|86159052|ref|YP_465837.1| protein of unknown function DUF395, YeeE/YedE [Anaeromyxobacter dehalogenans 2CP-C]
    MEQRPYWNPYKAGFLLGLVLLGSFVLTGRGLGASGSFKHVVAAGLHAVSPTWTEENVSVGRFFADPSRASMDDWIVWLTA
    GTLLGGAVAVVTARRFKAETVMGPRADRRWRWVLAGAGGALAGFGAQLARG
    CTSGQALTGGAQLALGSWLFMLCVFGGAY
    ALAWFVRRQWI

    >gi|86159074|ref|YP_465859.1| rhodanese-like protein [Anaeromyxobacter dehalogenans 2CP-C]
    MSGSRPAVAAALALAALTACSRAPAGPPAAPVVDGPDAKALVEAGARLVDVRTPQEFAAGHAPGAINVPYDEIARRAPGE
    LPDRDAAIVLY
    CRTGRRSAIAAKALRELGYTRLHDLRRADAWPGPLESTR

    >gi|86159549|ref|YP_466334.1| alkylhydroperoxidase AhpD core [Anaeromyxobacter dehalogenans 2CP-C]
    MQPRIDYGKVAPGALRAMYALEQYVRSSGLDLTLYHLVKLRASYINGCAFCVDMHTKEARAHGETEQRLYAVPVWRETPF
    FTPRERAALAWTETVTRVGETGVPDESYEQVRAEFDDAELVNLTLAIVAINGWNRLSVAFRAPVGTYQVGANRAPAEPAA
    QRA

    >gi|86159809|ref|YP_466594.1| hypothetical protein Adeh_3390 [Anaeromyxobacter dehalogenans 2CP-C]
    MRRPPLAAALLALAAACAAPRTQQRPIPRPPPGPSRLVGAEVSFSAPDLAGRDVQVGGAAGRGLVQVVDFWASWCEPCKE
    QLPHLDRMAREHRDDGLRVTGVAFDEERAAVEAFLAPAPVAFQILWDPGGAALGERLDVQRLPTTLVIDRRGVVRHVHRG
    YDRAEGEKLEDEVRQLLAEPAP

    >gi|86159896|ref|YP_466681.1| HesB/YadR/YfhF [Anaeromyxobacter dehalogenans 2CP-C]
    MEATTVAAPTAPSPDLGIPNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKDPRDGDISLEQDGI
    KLYVDPMSSMYLQGVTVDYVVGLQGAGFKFNNPNARTTCGCGSSFSY

    >gi|86159911|ref|YP_466696.1| UBA/THIF-type NAD/FAD binding, MoeZ/MoeB fmaily protein [Anaeromyxobacter dehalogenans 2CP-C]
    MSIGRPASELPELSKEEILRYSRHLIIPEVGVEGQKRLKAARVLLVGAGGLGSPNALYLAAAGVGTLGIVEADVVDLTNL
    QRQVLHGTKDVGRKKLESARERIRDVNPHVKVIAHDAWLTSENALEILSGYDLVVDGTDNFATRYLVNDACVLLGKPNVY
    GSIFRFEGQSTVFCTAGGPCYRCLYPEPPPPGMVPS
    CAEGGVLGILPGLVGLIQATEAVKLITGVGEPLVGRLLLVDALG
    MEFRTVKLRKDPRCPACGTHELQALIDYQQFCGIRGGEAEQAMDGVPTITAGELDARRRRQDDFDLIDVREPHEWEIGRI
    EGARLAPLSTFAEALRTFDSARDLVLY
    CRSGQRSAKAVRQLQEAGFRRVWNLEGGILRWSEEIDPTVPRY

    >gi|86159914|ref|YP_466699.1| copper-translocating P-type ATPase [Anaeromyxobacter dehalogenans 2CP-C]
    MSDRVETTVRGREPAAARAAAVEASPEDRRARVTINVSGMTCAACQARVQKALSGAPGVLDASVNLMTAEAAISYDPAVA
    APEALIERVRSTGYGAALSEPGADALEQQDAARAKEFRELRARALVALAAGVVAMIASMPLMAAHAHHGLGAPTDPFMSW
    SMRVLDPVLERALPWLYAIPEQVLSYGLLALTTAVMAWAGRHFYTRAWAAFRHHSADMNTLVAVGTGAAYLLSLAATVAP
    GFFVSRGVPPDVYYEAVVLIIALILVGNTMEARAKRQTSVALRKLMQLQPRTARVVRGGAEVDVPVEDVREGDVVVVRPG
    ERLPVDGEIVSGTSAVDESMLTGEPLPVQKRAGDRVIGATVNGTGSFRYRATGVGADTVLAHVVKLMREAQGSRAPIQKL
    ADRISGIFVPVVLSLSIATFVVWFVAADAAPAVRALVAAVAVLVIACPCAMGLAVPTAVMVATGKGAELGVLLKGGEALE
    RAHAVDTVVLDKTGTLTLGKPAVTEVRLAPGAPVDEDALVGLVAAVERASEHPLAAAIAAHATARGAAVPQVEAFESITG
    RGARGLAGGRRVVVGNAALLESEGVSTAPLEAEAGALAAKARTAVFAAVDGKLAGLLAVADELRPTSRDAVARLRRMGLE
    VVMLTGDVRRSAEAVAKAAGVERVVAGVLPEGKVAEVERLQAEGRVVAMVGDGINDAPALARAEIGIAMGSGTDVALEAA
    DVTLMRPDLRAVADAIALSRRTMRTMRQNLFWAFAYNVVGIPVAAGVLFPAFGLMLSPVLASAAMAFSSVSVVTNSLRLR
    RFRGA

    >gi|86159926|ref|YP_466711.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-C]
    MAAPLIYRCARCGAMNRLALLTPGRQPVCGKCKADLDTSGAPGHADLAALERAVGSSPAPVLVDFWAPWCAPCRAFAPVL
    ERLAREQAGRLVVLKVDTEASPAAGARFGIQAIPTLVVFRDGKEVDRVSGALPYEELRRFTTAATLGVAG

    >gi|86159933|ref|YP_466718.1| thiosulfate sulfurtransferase [Anaeromyxobacter dehalogenans 2CP-C]
    MRFGPLVAAPALLTSLQDARLLDARPGPDAYAAGHLQGALHADLNVHLSAASAPGFDPARGGRHPLPEPAAWAAQLGAWG
    IGPDTRVVVYDAAGGQNAAARLWWMLRAFGHAQVAVLDGGYPAAREAGVPVTSAPGAVAALPPYPAQAWSLPTLSIDEVA
    RRLGDPAWKVLDVRSRERWRGEVETLDPVAGRIPGTLNLPCAENLGPDGRFLAPEALRRNYLALLGGTPPEHLVVH
    CGSG
    VTACHTLLALDAAGLGGAALYVGSFSEWCRSGRPIGKG

    >gi|86160059|ref|YP_466844.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
    MTITRSFLLAALAALGLAGLPACKTAAPAPGAPAAGAAVPASEAAAADPLAGADLDDLTPEQRAVVRDWASRAFCYCGCP
    HTVTSCLRTHQPCKHAARMTQLAARLVAAGASPSALPGLVDDYYASFDRRVALATDGFGPPLGDAAAPVTLVEFSDFT
    CP
    FCRGLRPQLERFVEEHAGRVKLVFKPFPIEAHPGALEAAQAGEWARDQGVFWPLHDALFEAEAPLGVDAIAEAARAAGGD
    AGDLRDALASRKYLDKVRVSQAEARAAGLRGTPTLFLNGRYLALPDYSPAMLLHALEDEEEWQKHQGWEKD

    >gi|86160324|ref|YP_467109.1| hypothetical protein Adeh_3908 [Anaeromyxobacter dehalogenans 2CP-C]
    MRLRVGDRAPAAALDDVDGRRLECSRPGTPAVVLFTRYVGCPVCQLHVARIAAAMPEFRARSCGVWMVFQSSAEHLRAAM
    AEWRPGFSAVADPTARLYDAFAVEASVAGYLAPRSLLALVHATMAGKRHGRFEGRETQLPAAFVLAPAGRIAFAHFGRSI
    GDDAPIPALLGAVDSTNRDASARTPP

    >gi|86160366|ref|YP_467151.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
    MRNVVLGALAVLAAACQSPRPAQPAQQKENPSAPVAKVGGQAITAGELDELVKSDLKQLEQQYEEQKYQLKRQGLESMIR
    RRVFEAKAKAEGITPDELVNRDVVAKIPEPADDEVRALYERAKAGGQQLPPIDQVKPDIARFIKNQKAQAELTAYYEKLK
    KDMNVEVLLPAYMPPKVEVAATGPSKGPADAPITIVEFSDYQ
    CPFCVRAEPTMKDVMAAYPGKVRVVYRDFPLPSHDLAP
    KAAEAAHCAGDQGKYWEMHDRLFAANGKLAVDDLKGYAREVGVDGAKFDRCLESGEKAPVVQEHHKAGEAAGVSGTPAFF
    INGRLISGAQPLEAFKAVIDQELKAAGKL

    >gi|86160367|ref|YP_467152.1| thioredoxin reductase [Anaeromyxobacter dehalogenans 2CP-C]
    MSKHERLVIVGSGPAGYTAALYAARANLRPLLFEGMQPGGQLTITSEVENFPGFPEGILGPELMEKMKKQAERFGTRFEA
    SEITRVDFSQRPFKLWQDDTLYTADAVIIATGASAKWLQIPSEKQYQGRGVSA
    CATCDGFFFRGVEVAVVGGGDTALEEA
    SFLTKYASKVHVVHRRGELRASKIMQDRARKNPKIELALNAVVDEILGDGKAVTGVRLKDTRDGSTRELPLKGVFMGIGH
    EPNTGIFKGQLEMNEVGYLAVKAPSTATSVAGVFAAGDVSDPHYRQAISAAGTGCSAAIDAERWLGEHVTESWN

    >gi|86160438|ref|YP_467223.1| rhodanese-like protein [Anaeromyxobacter dehalogenans 2CP-C]
    MIRISTEEAAQLIAQGGYDLVDVREPHEWAGGHIPGARHVPLGALARAPADHLTRDRVIFVCGHGMRSQTACAIARGAGL
    SQVFSVDGGVVGWAAEGRPLAA

    >gi|86160456|ref|YP_467241.1| electron transport protein SCO1/SenC like [Anaeromyxobacter dehalogenans 2CP-C]
    MSTRSARPAAALAALVALVGLAACKESRPAVSQAELDRFGIERATSVPAPPIELISLDGTRFSLESAKGQVVFVNFWATW
    CPPCRTEMPSMLALGRELEAKYPGKFRMVAVSVDEAWDPVREFISAPPYMGSTAGATVVLDADQSVTMRYYCAARGGCPD
    SYKFPESYIVGKDGKLVSMVIGPREWSVPVARAYLEQLIGS

    >gi|86160465|ref|YP_467250.1| DsbA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-C]
    MKHVSWVVALVIGFAIGFVGRGSWDMGGRPSRAPAGAPTRARPVEDPKAVYRVPADDSPVRGPADALVTIVESSDFQCPY
    CKRGAATMKQVEDAYRGKVRFVFKHNPLSFHPQAMPAALAAEEARAQGGDEKFWALHDKLFDSAPALDQAAIEKAAGELG
    LDVAKVREAMQSGTHRARIERDQKLVVGLGAPATPTFFVNGRKIAGAQPIEAFRTVIDEELRKAEQLVRSGTPAAQVYAK
    TIERGATAPVFLPGTVPPPAAAAPSAAAPAPAAPAAPPPATYAKVPLRADDPARGPADAKLTVVLFSDFQ
    CPFCSRVEPT
    LKQLEEAYPGQVRIVWKHQPLSFHPNALPAAIAAEAARDQGKFWPMHEKLFANQQALSPATYEQYAKELGLDLRKFQAAV
    AARKGADRIAADQQLANGVGANGTPTMFFNCRQVVGALPLERMRPIVEEELKKADALLKGGKAGPGFYEQACQANLALKP
    AAPQQGAVIPAALPAGQPVQGLAVRADDPTRGNPKAPVTIVLFSDFQ
    CPFCARVEPTLAQVQKTYGDKVRVVWKHQPLGM
    HPNAMPAAEAAEAAREQGKFWQMHEKLFASQRELSDALYERAAREIGLDVARFDAARRSGRGRARIAEDQALAARIGAQA
    TPTMFVNGVKVEGAVPFEQIRAVVDAELARR

    >gi|86160488|ref|YP_467273.1| hypothetical protein Adeh_4072 [Anaeromyxobacter dehalogenans 2CP-C]
    MASETFVTFPGGKRVDTTIGNHVIRTDQPVASGGEDSAPSPFNLFMAAIGTCAGIYVLGFCQKRDLPTDGIRLRQRAHFD
    PETGVLARVELDIEVPPAFPEKYREALVRVADQ
    CAVKKAIQAQPVFDVKTVVGA

    >gi|86160580|ref|YP_467365.1| CoB--CoM heterodisulfide reductase subunit A [Anaeromyxobacter dehalogenans 2CP-C]
    MASSRIGLYFCRCGPNLGRAVRLPDLSAPGAFPAAADVAVHDVLCSPEGQAWLAERIRARGLDRVVLGACSPREHEHTFR
    GVLAGAGRSPWQLHMVNLREQVEWLGGAPADVTARARRLVAAGLARVALQRPLPEADVEVSADALVVGGGAAGISAALAL
    AQKDRKVVLVERAHALGGLANRLDEVFPDLACAS
    CFMEPALDRVLHSDRVEVVTGAEVRRVRGSAGRFTVELAVAPRHVD
    PAACLGCAEVCGAACPVELADPPGGGPARKAIHLPYPGCLPHAAVVDRAACLPGCDACAGACPFGAVRLGEAPRLGEVEV
    GAIVIATGLEPGAVDGPEGLVSSYQLERMLHPDGPTGGALRGAGGRTPEAVLLATTAAEADGELALREVLKLAQRVRARL
    PSARVAVAGGLDRAPQLAGLAAALRRDGVELLPGALVEGGVAAAAAGALEVRLAEPGGGTTRRRADLVAVHAPSRGSSGA
    AALAALLRLAPDGRGFLGDGGASPFEPTATRTAGVYVAGAAAGPRSIREAIRDGAAAAGQVLATLRPGERRALEPLAAEV
    DAALCGGCGMCVAACPFGAMVIDGADGKARVLAGDCRGCGTCAAACPTGAASARHFTRAQIAAEISALLAGR