Lactobacillus reuteri JCM 1112 uid58875

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|184152694|ref|YP_001841035.1| hypothetical protein LAR_0039 [Lactobacillus reuteri JCM 1112]
    MSKYKVTATKTTTGMQVSAGTRGFEITFDEPESTNTGMNPVEILLASFGACQAITAQALAKKRNFDLRAFWVTIEGDLGR
    EDVADGKNVRKFTEIRYQPHLRSSESDEDIKKFLADVAAKCPVENTLTYGTKFVQDGFVKVD

    >gi|184152719|ref|YP_001841060.1| NADH oxidase [Lactobacillus reuteri JCM 1112]
    MKVIIVGCTHAGTITATQILQNHPETEVTIYERNDNVSFLSCGIAVYLSGDVGNPDAMFYSSPEQLAAMGATVHMQHNVT
    DIDPKTKTVTVTDLVTGETKTDHYDKLVDTTGSWPVIPPIEGVDGPHVYLCKNYHHAKELFNVAKDAQRIVVIGGGYIGV
    ELVEAYTRQNKDVTLIDGSPRMLHKYFDREYTDRIQQEFVDHGAHFAFDQRVTGFENHENGVTVKTDKGNYEADIAILCV
    GFRPNTDLLKGKVKMHDNGAIITNEYMQSSDPDIYAAGDSTAVHYNPTGKDAYIPLATNAIRQGTIVGTNLFGNTMRDMG
    TQSSSGLNLYGTTMVSSGLTLENAKEAGFDAAAVTVEDNYRPEFMPTTTPVLMTLVWDKKTRQILGGQFMSKHDVSQSAN
    IISLCIQDKHTIDYLAFVDMLFQPHFDRPFNYVNILGQAAVKKQAELEK

    >gi|184152822|ref|YP_001841163.1| pyridine nucleotide-disulfide oxidoreductase [Lactobacillus reuteri JCM 1112]
    METVKNIIIGFGKGGKTLAKFLAQHGEQVLVIEKSKQMYGGTCINIACLPSKRLIIEAAHGTSFEDAVDGKNVMTSQLRQ
    KNYQMLASEDNITVLDGTAHFTGNHTIDVQTPDGHTLSYKGERIFINTGATSTIPDIPGLKDSRFLMNSTQAMDQPKLPR
    ELVIIGGGYIGLEFANMFTSFGSHVTVLDHHQTLLPREDDDVAEMVIQNFKDNGVRFEVGVDIKAIGEQDNQAAITFART
    DNRETTIFADKILVATGRKPATAALDLQNTDIKVAKNGAIVVDDLLHTSVPNVWAIGDVKGGPQFTYISLDDFRIIKDEL
    FGNKERRISDRLIVPTNVFIEPSLAQVGLTEREAQKQEKDYLLFKMPAAAIPKAKVLKDTRGLLKVLVDPQTNLIIGATL
    YVQEAQEIINMIVLAMRAKLPYQMLRDQIYTHPTISEAFNDLFKQSVDKKE

    >gi|184152834|ref|YP_001841175.1| peptide methionine sulfoxide reductase [Lactobacillus reuteri JCM 1112]
    MDKNELKKLTPMQYAVTQMGVTEKPYSGKYDRFDEPGIYVDVVSGEPLFSSLDKYDAGCGWPAFTKPIKKRVLTEKRDQS
    FGMERTEVRSKEADSHLGHVFTDGPTDRGGLRY
    CINSAALQFIPVDKLQEKGYGEYLSLFDK

    >gi|184152968|ref|YP_001841309.1| putative glutaredoxin [Lactobacillus reuteri JCM 1112]
    MKMVTVFSKNNCIQCKMTKRFLEQHKISFIEHNIDEQPEYISQLKSEGFMATPVVKLPNGQAFSGFRPDQLNQLA

    >gi|184153020|ref|YP_001841361.1| thioredoxin reductase [Lactobacillus reuteri JCM 1112]
    MAESKQYDVVIIGAGPGGMTAAMYASRANLSVLMLDRGIYGGNLNNTAEIENYTGFKSVKGPELAQQMYEGATQFGAEYA
    YGTVTKVELDGDLKKITTDMDETYTAKAVVIATGSDQRHLNVPGEEEFGGRGVSY
    CAVCDGAFFKGKHLIVVGGGDAAVE
    EGVYLTQLASKVTVLVRRDELRAEPIIQAEAMNNDKIEFVYNTSVTEIVGDDIKVTGVKTHNNKTGEDGEMAADGVFIYV
    GNFPMTAAFKNLDILDDQGWVKTDERMRTAVPGIFAIGDVRETPLRQVATAVGDGAIAGQQVYQYIKSMA

    >gi|184153180|ref|YP_001841521.1| thioredoxin [Lactobacillus reuteri JCM 1112]
    MAVNVTTDQTFEQDTATGVDLIDFWATWCGPCRMQSPVVDALSDKMPDIKFFKMDVDQNPETAQKFRIMSIPTLMVKKDG
    KVVDQIIGYHSEDQLKQILQQYVD

    >gi|184153206|ref|YP_001841547.1| hypothetical protein LAR_0551 [Lactobacillus reuteri JCM 1112]
    MVTLYTSPSCTSCRKARAWLKEHDIAFKERNIFSEPLSLNEIKNILRMTEDGTEDIISKRSKAYQKLSVDLNDLSMKALF
    KLISKNPGLLRRPIIIDDKRLQVGYNEDEIRRFLPRKVRELELVEAQEKANMI

    >gi|184153266|ref|YP_001841607.1| dihydrolipoamide dehydrogenase [Lactobacillus reuteri JCM 1112]
    MADVEQKDTVIVGGGPGGYVAAIRASELGQKVTLIDKGEPGLGGVCLNVGCVPSKALIAAGHRYQETLDSSIYGISKTDA
    KLDFTKTQEWKDHKVVDRMIRGVKMLLKKHKVEIIDGEAILDNDHQLRVIKPGPKQFMDNDNGRTITWKNLILATGSRPV
    EIPHFKFEGRVIDSTGGLNLKEVPEELVVIGGGYIGTELAGAYADLGAHVTIIEGTDSILGGFDHDMVDIVVKNLEKKGV
    DIVTKAMAKDSQQDENSVTVTYEVDGSEKSIKADYCMVSVGRKPNTDDFGLDMTNVKLNDRHQVIVDEQGRTNVPGIWAI
    GDIVPGPALAHKAFFEAKTAAGAIAGKNTANDWVGVPMVCFADPELAQVGMTVEEAKDKGIDVSTAQFPFAGNARAVSLD
    AAEGFIRLIYTKDKKNVIGAQGVGPGVSDLAGELSLIVNCGMNVEDVALTIHPHPTLNEPVQEAADIALGFPTHI

    >gi|184153570|ref|YP_001841911.1| hypothetical protein LAR_0915 [Lactobacillus reuteri JCM 1112]
    MEIQYWADIACPYCYMGITQLQRALKELKIADQTPLKFMSFQLDPTLPTTTDLSMTEYYAKTHQLTKQEAATQIQKIDQL
    AADIDLPIKMENAIPVNTLTAHRLIKYIESLNDQALLNKAVKRLYQLYFNDNESIADYEALTGAMNEIGLPVADVKKVLE
    SNQYEDEVRKNEQRAFMIGMPSAPLFVINNKYSITGAQPYEVFLEALKKVKNITK

    >gi|184153595|ref|YP_001841936.1| molybdopterin biosynthesis protein MoeB [Lactobacillus reuteri JCM 1112]
    MNRYDRQERVHQIGVVGQQKISHATIMIVGVGALGSYTAEQLVRAGVKRLVLIDPDTVDVTNLQRQSLFTEADANQQRLK
    VEAAKEHLHKINSACQIIAIPAPITADLIDEYQFTLCLDCLDNYQARDLLNKLAIIKNFDYLFASCAGTYGNVMAISPQN
    YPCLNCLFPNINELKQND
    CDLIGVNTALIPIVAGLQVSLALHYLVDKTQVNFNELITVDNWSMQFSKFIINKNSHCPACT
    NPSSISLEEESAPELHMLCGENAYYTVKEKPINFGRLKEFLAKKELLINANRLFLHFKWENRPVSIFKNGKIVMYDLPTS
    AIAQKQFESLNTLMKEDLL

    >gi|184153673|ref|YP_001842014.1| thioredoxin reductase [Lactobacillus reuteri JCM 1112]
    MAEQHLYDLIIVGAGPAGLSAGLYAGRATLDTLILEGDTVGGQVTTTSVVYNYPAVEKVDGTQLMNQMQSQVASFGVEIQ
    HDAVEKFDLTGEVKTLIGKSGQKYTARSVIIATGANPKKVGFPGENEFRGRGIAY
    CSTCDGELFTGLQVFVVGGGYAAAE
    EADYLSRFAKHVTVLVRGDHFACPVLTAKRALDNPKVSVEYNTEVKEVSGDDYLTTATLVNNKTGEETVYHVDDGDQTFG
    MFIYIGTQPATKALANILDLDDRGYIMTDENGKTNIDGVYAAGDVIHKNLRQIVTAASDGAVASTAAERYIILQKEKQGI
    PIHAETNKKPAKTVGQTSELSQQENTTSHEGNWLPAEIDQQLQPIFARLTKDIKLQVLTNGTELSNQLVSFVEEFASLDK
    HLQMETKPAPADVKYLPQLRLLDADGNDTGLHYAGIPTGHELNSLVLGVYNVAGPGQTIAPEMVERIKKLAPTKIRIGVS
    LT
    CHFCPDVVAACQRMASLNTGITATMIDLQHFPELRKEKKIMSVPATMIDDDPVIFGSQSLEELVTAVEKHHQN

    >gi|184153674|ref|YP_001842015.1| alkyl hydroperoxide reductase [Lactobacillus reuteri JCM 1112]
    MNFVGHEIEDFKVNAYHDGETTEVSKKDVLGKWSVFFFYPADFSFVCPTELEALQDKYEDFKKANAEIYSVSEDTEFVHK
    AWAQASDKIGKIKYSMLADPAGKLARMFDVLDEDAGQAYRGVFIIDPDGIIQSYTINNMGIGRSADEILRTLQAAQFVRE
    HGDRVCPANWKPGQDSIKPSLDLVGKL

    >gi|184153786|ref|YP_001842127.1| peptide methionine sulfoxide reductase [Lactobacillus reuteri JCM 1112]
    MVVIKKGLIYMSLDTAIFAGGCFWCMVQPFDTYPGIEKVESGYTGGHVANPTYEQVCSGTTGHTEAVKITFDPDKISYKD
    LVEIYWHQTDPTDASGQFQDRGDNYRPVIFVKNDEQRKIAEKSKKALQESGRFGDAKIVTTIEDVQPFYPAEDYHQGFYK
    KDPQRFALEEAGGRQQFIEKYWKNN

    >gi|184153841|ref|YP_001842182.1| thioredoxin [Lactobacillus reuteri JCM 1112]
    MRIMKRLPQLKEDQLIETIGNGKVVLFFTADWCPDCRFIKPAMPEIEQDFSDYTFYEVDRDENIDLAAELNVFGIPSFIV
    YDNGKEIGRFVNKDRKTKQQVEDFLNNLK

    >gi|184153978|ref|YP_001842319.1| hypothetical protein LAR_1323 [Lactobacillus reuteri JCM 1112]
    MIARFNYFSPLGIIKIQADAIGITEVKFVDQSERDNLNPNYPAIKDAVRWLDDYFLGNVPLTYPQFHLNGTDFQQRVWQQ
    LRQIPYGTTVTYGQLAQRLNSSPRAVGNAVGKNPILLFIP
    CHRILGQNGKLTGYSGGLERKKKLLAIENIKL

    >gi|184153982|ref|YP_001842323.1| hypothetical protein LAR_1327 [Lactobacillus reuteri JCM 1112]
    MKKYDDILIGSGPAAYKMANLLAKTDRKVLVIEGFEYGGTCPNYGCEPKIFLEGAARTVLQSQQLLGRGISQPAKLDWEA
    LMQTKLKRFDPWPGETRDIIKKSYDIEDGYASFVDNHTITVNGHQYRADHIIIATGQTPNILDIPGKEYLYTSYDLLSLK
    ELPQRITIIGAGFVGLELATLVAAAGAEVTIVVHSDRVLREFTKAEDEVLVNAMKQRGIKFSFNTDTQKVSQRKDGLLVI
    TNHGEVQADYVLDATGRHPNIEKLALENTDIEYDRHGINVDDHLMTTVDGVYAIGDVVNRKQPKLTPVAEFEGQYLFDYL
    TGKTDQDIVYPTIGQAAFTFPEVARAGVNPDDVTGDSQYQVKTVSLKYGSLYAGQNDQISTLTLVFKDQQLVGASEIGDY
    AADDINNFLPIIGLKINGDEYRQKVMAIYPTLGDKVAGLLP

    >gi|184153995|ref|YP_001842336.1| copper chaperone [Lactobacillus reuteri JCM 1112]
    MEKVMMKLDGLTCPSCLTKIQKSVETIDGTDDVKVLFNAGKVKFTLDLAKASPDDVQANIEKMGYTVQGIKVKELSDD

    >gi|184154363|ref|YP_001842704.1| thioredoxin [Lactobacillus reuteri JCM 1112]
    MAIDATAETFDKDVQGSMTVVDFWAPWCGPCKMMEPAMQNLEKQYGDKIKFVRMNVDGNQEIAQRYKVMSVPSLVLFKDG
    QAKEKVTGYYPEAKLAHYFERKITE