Lactobacillus reuteri DSM 20016 uid58471

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148543285|ref|YP_001270655.1| OsmC family protein [Lactobacillus reuteri DSM 20016]
    MSKYKVTATKTTTGMQVSAGTRGFEITFDEPESTNTGMNPVEILLASFGACQAITAQALAKKRNFDLRAFWVTIEGDLGR
    EDVADGKNVRKFTEIRYQPHLRSSESDEDIKKFLADVAAKCPVENTLTYGTKFVQDGFVKVD

    >gi|148543309|ref|YP_001270679.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri DSM 20016]
    MKVIIVGCTHAGTITATQILQNHPETEVTIYERNDNVSFLSCGIAVYLSGDVGNPDAMFYSSPEQLAAMGATVHMQHNVT
    DIDPKTKTVTVTDLVTGETKTDHYDKLVDTTGSWPVIPPIEGVDGPHVYLCKNYHHAKELFNVAKDAQRIVVIGGGYIGV
    ELVEAYTRQNKDVTLIDGSPRMLHKYFDREYTDRIQQEFVDHGAHFAFDQRVTGFENHENGVTVKTDKGNYEADIAILCV
    GFRPNTDLLKGKVKMHDNGAIITNEYMQSSDPDIYAAGDSTAVHYNPTGKDAYIPLATNAIRQGTIVGTNLFGNTMRDMG
    TQSSSGLNLYGTTMVSSGLTLENAKEAGFDAAAVTVEDNYRPEFMPTTTPVLMTLVWDKKTRQILGGQFMSKHDVSQSAN
    IISLCIQDKHTIDYLAFVDMLFQPHFDRPFNYVNILGQAAVKKQAELEK

    >gi|148543413|ref|YP_001270783.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Lactobacillus reuteri DSM 20016]
    METVKNIIIGFGKGGKTLAKFLAQHGEQVLVIEKSKQMYGGTCINIACLPSKRLIIEAAHGTSFEDAVDGKNVMTSQLRQ
    KNYQMLASEDNITVLDGTAHFTGNHTIDVQTPDGHTLSYKGERIFINTGATSTIPDIPGLKDSRFLMNSTQAMDQPKLPR
    ELVIIGGGYIGLEFANMFTSFGSHVTVLDHHQTLLPREDDDVAEMVIQNFKDNGVRFEVGVDIKAIGEQDNQAAITFART
    DNRETTIFADKILVATGRKPATAALDLQNTDIKVAKNGAIVVDDLLHTSVPNVWAIGDVKGGPQFTYISLDDFRIIKDEL
    FGNKERRISDRLIVPTNVFIEPSLAQVGLTEREAQKQEKDYLLFKMPAAAIPKAKVLKDTRGLLKVLVDPQTNLIIGATL
    YVQEAQEIINMIVLAMRAKLPYQMLRDQIYTHPTISEAFNDLFKQSVDKKE

    >gi|148543425|ref|YP_001270795.1| methionine-R-sulfoxide reductase [Lactobacillus reuteri DSM 20016]
    MDKNELKKLTPMQYAVTQMGVTEKPYSGKYDRFDEPGIYVDVVSGEPLFSSLDKYDAGCGWPAFTKPIKKRVLTEKRDQS
    FGMERTEVRSKEADSHLGHVFTDGPTDRGGLRY
    CINSAALQFIPVDKLQEKGYGEYLSLFDK

    >gi|148543561|ref|YP_001270931.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Lactobacillus reuteri DSM 20016]
    MVTVFSKNNCIQCKMTKRFLEQHKISFIEHNIDEQPEYISQLKSEGFMATPVVKLPNGQAFSGFRPDQLNQLA

    >gi|148543612|ref|YP_001270982.1| thioredoxin reductase [Lactobacillus reuteri DSM 20016]
    MAESKQYDVVIIGAGPGGMTAAMYASRANLSVLMLDRGIYGGNLNNTAEIENYTGFKSVKGPELAQQMYEGATQFGAEYA
    YGTVTKVELDGDLKKITTDMDETYTAKAVVIATGSDQRHLNVPGEEEFGGRGVSY
    CAVCDGAFFKGKHLIVVGGGDAAVE
    EGVYLTQLASKVTVLVRRDELRAEPIIQAEAMNNDKIEFVYNTSVTEIVGDDIKVTGVKTHNNKTGEDGEMAADGVFIYV
    GNFPMTAAFKNLDILDDQGWVKTDERMRTAVPGIFAIGDVRETPLRQVATAVGDGAIAGQQVYQYIKSMA

    >gi|148543774|ref|YP_001271144.1| thioredoxin [Lactobacillus reuteri DSM 20016]
    MAVNVTTDQTFEQDTATGVDLIDFWATWCGPCRMQSPVVDALSDKMPDIKFFKMDVDQNPETAQKFRIMSIPTLMVKKDG
    KVVDQIIGYHSEDQLKQILQQYVD

    >gi|148543802|ref|YP_001271172.1| arsenate reductase and related [Lactobacillus reuteri DSM 20016]
    MVTLYTSPSCTSCRKARAWLKEHDIAFKERNIFSEPLSLNEIKNILRMTEDGTEDIISKRSKAYQKLSVDLNDLSMKALF
    KLISKNPGLLRRPIIIDDKRLQVGYNEDEIRRFLPRKVRELELVEAQEKANMI

    >gi|148543866|ref|YP_001271236.1| dihydrolipoamide dehydrogenase [Lactobacillus reuteri DSM 20016]
    MADVEQKDTVIVGGGPGGYVAAIRASELGQKVTLIDKGEPGLGGVCLNVGCVPSKALIAAGHRYQETLDSSIYGISKTDA
    KLDFTKTQEWKDHKVVDRMIRGVKMLLKKHKVEIIDGEAILDNDHQLRVIKPGPKQFMDNDNGRTITWKNLILATGSRPV
    EIPHFKFEGRVIDSTGGLNLKEVPEELVVIGGGYIGTELAGAYADLGAHVTIIEGTDSILGGFDHDMVDIVVKNLEKKGV
    DIVTKAMAKDSQQDENSVTVTYEVDGSEKSIKADYCMVSVGRKPNTDDFGLDMTNVKLNDRHQVIVDEQGRTNVPGIWAI
    GDIVPGPALAHKAFFEAKTAAGAIAGKNTANDWVGVPMVCFADPELAQVGMTVEEAKDKGIDVSTAQFPFAGNARAVSLD
    AAEGFIRLIYTKDKKNVIGAQGVGPGVSDLAGELSLIVNCGMNVEDVALTIHPHPTLNEPVQEAADIALGFPTHI

    >gi|148544207|ref|YP_001271577.1| DSBA oxidoreductase [Lactobacillus reuteri DSM 20016]
    MEIQYWADIACPYCYMGITQLQRALKELKIADQTPLKFMSFQLDPTLPTTTDLSMTEYYAKTHQLTKQEAATQIQKIDQL
    AADIDLPIKMENAIPVNTLTAHRLIKYIESLNDQALLNKAVKRLYQLYFNDNESIADYEALTGAMNEIGLPVADVKKVLE
    SNQYEDEVRKNEQRAFMIGMPSAPLFVINNKYSITGAQPYEVFLEALKKVKNITK

    >gi|148544295|ref|YP_001271665.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri DSM 20016]
    MAEQHLYDLIIVGAGPAGLSAGLYAGRATLDTLILEGDTVGGQVTTTSVVYNYPAVEKVDGTQLMNQMQSQVASFGVEIQ
    HDAVEKFDLTGEVKTLIGKSGQKYTARSVIIATGANPKKVGFPGENEFRGRGIAY
    CSTCDGELFTGLQVFVVGGGYAAAE
    EADYLSRFAKHVTVLVRGDHFACPVLTAKRALDNPKVSVEYNTEVKEVSGDDYLTTATLVNNKTGEETVYHVDDGDQTFG
    MFIYIGTQPATKALANILDLDDRGYIMTDENGKTNIDGVYAAGDVIHKNLRQIVTAASDGAVASTAAERYIILQKEKQGI
    PIHAETNKKPAKTVGQTSELSQQENTTSHEGNWLPAEIDQQLQPIFARLTKDIKLQVLTNGTELSNQLVSFVEEFASLDK
    HLQMETKPAPADVKYLPQLRLLDADGNDTGLHYAGIPTGHELNSLVLGVYNVAGPGQTIAPEMVERIKKLAPTKIRIGVS
    LT
    CHFCPDVVAACQRMASLNTGITATMIDLQHFPELRKEKKIMSVPATMIDDDPVIFGSQSLEELVTAVEKHHQN

    >gi|148544296|ref|YP_001271666.1| peroxiredoxin [Lactobacillus reuteri DSM 20016]
    MNFVGHEIEDFKVNAYHDGETTEVSKKDVLGKWSVFFFYPADFSFVCPTELEALQDKYEDFKKANAEIYSVSEDTEFVHK
    AWAQASDKIGKIKYSMLADPAGKLARMFDVLDEDAGQAYRGVFIIDPDGIIQSYTINNMGIGRSADEILRTLQAAQFVRE
    HGDRVCPANWKPGQDSIKPSLDLVGKL

    >gi|148544422|ref|YP_001271792.1| peptide methionine sulfoxide reductase [Lactobacillus reuteri DSM 20016]
    MSLDTAIFAGGCFWCMVQPFDTYPGIEKVESGYTGGHVANPTYEQVCSGTTGHTEAVKITFDPDKISYKDLVEIYWHQTD
    PTDASGQFQDRGDNYRPVIFVKNDEQRKIAEKSKKALQESGRFGDAKIVTTIEDVQPFYPAEDYHQGFYKKDPQRFALEE
    AGGRQQFIEKYWKNN

    >gi|148544476|ref|YP_001271846.1| thioredoxin domain-containing protein [Lactobacillus reuteri DSM 20016]
    MKRLPQLKEDQLIETIGNGKVVLFFTADWCPDCRFIKPAMPEIEQDFSDYTFYEVDRDENIDLAAELNVFGIPSFIVYDN
    GKEIGRFVNKDRKTKQQVEDFLNNLK

    >gi|148544623|ref|YP_001271993.1| methylated-DNA--protein-cysteine methyltransferase [Lactobacillus reuteri DSM 20016]
    MIARFNYFSPLGIIKIQADAIGITEVKFVDQSERDNLNPNYPAIKDAVRWLDDYFLGNVPLTYPQFHLNGTDFQQRVWQQ
    LRQIPYGTTVTYGQLAQRLNSSPRAVGNAVGKNPILLFIP
    CHRILGQNGKLTGYSGGLERKKKLLAIENIKL

    >gi|148544627|ref|YP_001271997.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Lactobacillus reuteri DSM 20016]
    MKKYDDILIGSGPAAYKMANLLAKTDRKVLVIEGFEYGGTCPNYGCEPKIFLEGAARTVLQSQQLLGRGISQPAKLDWEA
    LMQTKLKRFDPWPGETRDIIKKSYDIEDGYASFVDNHTITVNGHQYRADHIIIATGQTPNILDIPGKEYLYTSYDLLSLK
    ELPQRITIIGAGFVGLELATLVAAAGAEVTIVVHSDRVLREFTKAEDEVLVNAMKQRGIKFSFNTDTQKVSQRKDGLLVI
    TNHGEVQADYVLDATGRHPNIEKLALENTDIEYDRHGINVDDHLMTTVDGVYAIGDVVNRKQPKLTPVAEFEGQYLFDYL
    TGKTDQDIVYPTIGQAAFTFPEVARAGVNPDDVTGDSQYQVKTVSLKYGSLYAGQNDQISTLTLVFKDQQLVGASEIGDY
    AADDINNFLPIIGLKINGDEYRQKVMAIYPTLGDKVAGLLP

    >gi|148544642|ref|YP_001272012.1| heavy metal transport/detoxification protein [Lactobacillus reuteri DSM 20016]
    MEKVMMKLDGLTCPSCLTKIQKSVETIDGTDDVKVLFNAGKVKFTLDLAKASPDDVQANIEKMGYTVQGIKVKELSDD

    >gi|148545029|ref|YP_001272399.1| thioredoxin [Lactobacillus reuteri DSM 20016]
    MAIDATAETFDKDVQGSMTVVDFWAPWCGPCKMMEPAMQNLEKQYGDKIKFVRMNVDGNQEIAQRYKVMSVPSLVLFKDG
    QAKEKVTGYYPEAKLAHYFERKITE