Lactobacillus plantarum ST III uid53537

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308179370|ref|YP_003923498.1| glutathione peroxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVVLGLPSNQFHQEKADDDETHD
    YCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIKWNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSE
    D

    >gi|308179382|ref|YP_003923510.1| thioredoxin [Lactobacillus plantarum subsp. plantarum ST-III]
    MIEPVDKTTFATVADGTALTVVDFWADWCGPCKMQEPVLEALDELYDGQVKFASLDVDQHQKIAQQFEIMSIPALVIFKN
    GQPAEKVVGFHPQAALKKYLDQKLAEVKPA

    >gi|308179501|ref|YP_003923629.1| glutathione reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWP
    ALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLD
    LDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQ
    LTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVG
    ELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATL
    LSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY

    >gi|308179716|ref|YP_003923844.1| glutaredoxin-like protein NrdH [Lactobacillus plantarum subsp. plantarum ST-III]
    MKKVTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLKNQGFHAVPVVEINGEDSIAGFRPDALKQLAV

    >gi|308179772|ref|YP_003923900.1| NADH oxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MKIVIVGCTHAGTAAAAQILKDHPEATVTIYERDDNISFLSCGIYLYLGGKVNHLEDMFYSSPETLAKLGAMVRTKHNVL
    KIDAQSKTLQVVDMTTGKVFGDTYDKLIMTTGSNVAVPPIFGIDESKVLL
    CKTYSQAQEIYQTAQDNQRIAIIGAGYIGT
    ELSESYANTHHEVTLFQSHDQILNNYISKEISDQAVQLLKDHGVNVLLNHQVTAFTGNDDGELVIETNQGDFNADLAIVG
    TGFVPNTELLRGQVEMDKHGAIIINDYVQTSDPDIYAAGDSCVVNFNPTGRSAYTPLATNAVRQGALAGANVFGNQQRYM
    GTQATSAMQLFDHTLATTGLTLAMAKLNHIPAERVTYEGNWRPAYMPSTAKLMIELIYNPENRKILGAQFLSAHEVAQSA
    NALSIAIQNGNTIDDLAFVDMLFSPNFDEPFNYLNLVAQQAIEQERQAGRNHPRITAYGDWAKQNDKDLQ

    >gi|308179779|ref|YP_003923907.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum subsp. plantarum ST-III]
    MAKSYDVIIIGAGPAGMTAALYASRANLSVLLLDRGIYGGQMNNTAAIENYPGFKSVLGPDLAKDMYESATQFGAEYAYG
    SVESVEDRGDVKIVTTDSDTFETKALVIGTGSEYRKLGVTGEDTYGGRGVSY
    CAVCDGAFFRNKHVVVVGGGDSAIEEGT
    YLTQLADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKTGEDSEIAVDGVFIYVGIN
    PITKPFSNLGITDENGWIETNDHMETKVPGIFAVGDVRKKDLRQVATAVGEGGTAGQGVYTYITALGDKVNN

    >gi|308179784|ref|YP_003923912.1| NADH oxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MKVAIIGCTHAGIAAMKQILKYYPGTEITVYERHADISYMSCGTYLHLGGTIHNLDQALYANPSEFSEQGVQMRMQYDVI
    NVNADKHTILAQNLQTKELQTDHYDKLVMATGSITAIPAIPGVENPKVML
    CKTCEQAQQLYEAAKHAHHIAIVGGGYSGV
    ELAEGYVKSGHTVTLFQRGPHLINEYLDPQISEKIEDLLTTKGIQVRTNAQVTAFSDTADNRLRVATADSEEIFDMAVIC
    PGVIPQSELLAGQVNRTKQGAIVTDRYMGTSNPDIFAAGDVTEVNFNPTKEHAYMPLVSHAIRQGALAGINIFDKRLGAI
    GTQATTGMLIFDQTVACAGLTLTAAKAANFDAQAAFYEGNYRPDFMPTTAKVMIELVYDQQTRKVLGGQLMSAHEVSQSA
    NTLSVVIHNGNTIDELAFMDMLFSPNFDEPFNYLNLVAQAAVDQEHGYRRNN

    >gi|308179860|ref|YP_003923988.1| probable organic hydroperoxide resistance protein [Lactobacillus plantarum subsp. plantarum ST-III]
    MEELRLSDFPILYTTQAVNEDGIEGHAYIPNGLEVAVSSPLKAVPGSNPEQLIGLALSTCLNATLEAIEKEHGQTHQSKV
    VTTVKMSRDRFGYQFFLDARVTIPEVDAETAARWLAIAETR
    CPVAKLVGPSANVTIQLA

    >gi|308180201|ref|YP_003924329.1| glutathione reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MSEKFDVVYLGSGHGTFDGGIPLAARGKKVAVIEADLIGGTCPNRGCNAKITLDQPVALKNQVANFQGYGLRGEPTIDWQ
    ANFDHERDVIAGLPDMIAGLMTSAGVTLINGRGTFVDDHTIQVADKTYTADKIVIATGQHPHRLDIPGTELAHDSNDFLN
    LTTLPHHITVIGAGYIGLEFANMALTAGSQVTLLMRGDQALRQFHQPFVERLLAILVEQGLVLKREWVPTAIKSTGDHFE
    VLSADDKVTTDWILDATGRQPNTANLGLEKIGVDYTAAGITVDDHLQTSVAGIYASGDVLAKDQPKLTPTAIFESQYLTH
    LFMGDTNAPIKYPAIPSVVFTSPRLAQVGTLPTSDTHDIKVTVNDLKDDWFRQTTRDVTGHNLLVTDDQHRLIGAAELGE
    QAENTINTLLPAIQYQLTPAQREQLVTLFPSIGAAVWSAI

    >gi|308180265|ref|YP_003924393.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MKTKPEALMRDLYNLIINPATRDWERHLLVQAKNNRQQLSPTGQLKQLEADLRPLAMRNNLTPDVMDFYLAITGNAPMPT
    KNNVSAYPPLSSPYEERAVFAGG
    CFWCMVEPFDQRPGINNVISGYTGGSWAQPTYEQVIGQYTGHVEAVEIRYDSRKISY
    QNLVDIYWQLIDPTDRFGQINDRGSQYRPVIFYANQHQLTIAQASKQALVDSQRYQKPIVVAIEPLQQFWPAENYHQDFY
    RKQPRRYRQLKKAHDHYLNWLKFKNKF

    >gi|308180646|ref|YP_003924774.1| glutathione reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MADYDTIFIGSGHATWHAAVTLARAQQKVAIIEEDTIAGTCTNFGCDAKILLDGPFELTEQLKQYQGIGVNTTPSIDWSQ
    LMAYKQQVIQPLSVQMTAVFKQLGIKIITGHGELTDTHTVQVAGSTYTADTIVVGTGQRPAKLAIPGADLMHDSRDFLDL
    PTMPKRLTLIGAGIISLEFANMAVLLGSEVHIIEFADRALPAFYSEHVEKMIAHLQAAGVHFHFGEALSQVTKSATGLLA
    TTKNGLTIESDDIITATGRIPNIEHLGLTKVGIKTDRHGIIVDDHLQTNIPNIYASGDVISKTLPKLTPTATFESNYIAG
    QLLGSTAAIDYPVIPSVVFTLPRIAQVGIPVEAAKLDTEHFHVQALPYGKLLAFQYQNEVDADLQLIFDQENYLVGASIY
    GNGAPDLINLLTMIITDHVSANTLSQKIFAFPSASAGIIDMLTPLLHHD

    >gi|308180653|ref|YP_003924781.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MTETAIFAGGCFWCMVKPFDQQPGIKSVISGYTGGTVANPTYEQVASHTTGHTEAVKITFDPDVISYADLVEIYWRQTDP
    TDASGQFQDRGDSYRPVIFVNSEAQRRTATASRDALAASGKFAEPIVTTIEDAKPFYPAEAEHQDFYRRNPFRYQIEEMG
    GREAFIKQHWQ

    >gi|308180654|ref|YP_003924782.1| peptide-methionine (R)-S-oxide reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MDKQQGELRQRLTPEQYAVTQEAATERPFSGEYDNFYQEGIYVDVVSGQALFSSRDKYDAGCGWPSFTKPIDQTNLNEHR
    DESFGMHRTEVTSTQANSHLGHVFPDGPRDRGGLRY
    CINSAALKFIPVADLEKAGYGQYQSLFK

    >gi|308180729|ref|YP_003924857.1| NADH oxidase (putative) [Lactobacillus plantarum subsp. plantarum ST-III]
    MDEFAQITIFEKGPDVSFSNCALPYTFSDVIDQPDDVILKTPMQFEQQYNIDVQVNTTVVAIDAQTKTVMIKRQGQVATT
    IVPYDTLILSPGARPILPAVIAGIDRPNVKTVRNVQDVRTIQAYLTEQHVHDVTIVGGGFIGLEMAENLQQAGYQITIIE
    AAEHVLGTLDDEFAQLVHKELYDHGVQVILQEQVTAIDATQVQLASGRAVTSQLVIVAIGVTPVTELAVQAGCALGVTGG
    IKVDHRYQTSVADIYAVGDAIEVTNRLTRQSTRLALAFPAQMQARHMVDHLYGRTPQYQGVIGSQVLHVFTLNVASTGLN
    ATECEHQQLDYRFATVAPQNRVSVMPGTTAVFLKLIFSYPTGEILGAQAIGQSDVDKTIDIIASLITMHGRVSDLTDVEL
    CYSPWVSTAKNVVNMVGLVAENVLNDEFKQVAVTQVRQLVLAGAFIIDAREPQEYADGHIKGAHNIPLSQFRQRLVEIPT
    NQPVYIH
    CQTGQRSYNMVRALLQRGYTNVVNIAGSYAELVQYEYFNDQTTGRTSILTRT

    >gi|308180732|ref|YP_003924860.1| negative regulator of proteolysis [Lactobacillus plantarum subsp. plantarum ST-III]
    MIKLFTQAGCNSSRKARQCFRDHDIAFEEKNFSSAAPTVSELKQILCLTENGLEDIISTRSQSYPAIADKLPDMSFNETL
    RLLCEQPQLLRRPIIVGRNKLQVGFNDDDIRQFIPRHIRRLNFQQTLVGLVDM

    >gi|308180777|ref|YP_003924905.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    METAIFAGGCFWCMVQPFDSQPGIDSVVSGYTGGHTKNPTYEDVKAHTTGHTEAVKITFDPDIISYTELVNIYWHQTDPT
    DAMGQFQDRGDNYRPVIFVNGPEQRRIAEASKRALQVSERFSKPIVTAIEDAKPFYPAEARHQRFYKNNPVVFAEQEAGG
    RADFIAEQWADAPKVD

    >gi|308180957|ref|YP_003925085.1| dihydrolipoamide dehydrogenase [Lactobacillus plantarum subsp. plantarum ST-III]
    MVVGDFAEERDTMIIGAGPGGYVAAIRAAELGQKVTVVEKEYIGGVCLNVGCIPSKALISAGHRLQEAKDSKIFGIKNIQ
    DPVLDFKVTQDWKDHQVVDRLTGGVEMLLKKHKVEVVRGEAYMHDNHTLRVMNGDHTGQTYKFKHLIIATGSRPVEIPGF
    KFSGRVVDSTGGLNLPEVPKELVVIGGGYIGSELAGAYANLGAHVTILEGTPQILPNFEKDMVKLVLNSFKKKGVDVITN
    AMAKNSEQDDSGVTVTYAVDGKETEIHADYVMVTVGRRPNTDDMGLEYTDVKLTKRGLIEVDEQGRTAAEDIFAIGDIVA
    GAALAHKAFAEAKVAAGAISGKKTANDYVSIPAVCFTDPELATVGMTKAEAEEAGLQVKTSKFPFAGNGRAISLNAMDGF
    FRLVSTKDEGTIVGAQIAGPGASDLISELSVAVNGGMNVEDLALTIHPHPTLGEVVQEAADEAMGYPTHI

    >gi|308181025|ref|YP_003925153.1| negative regulator of proteolysis [Lactobacillus plantarum subsp. plantarum ST-III]
    MVILYTAPSCTSCRKAKAWLQTHDIDFQEHNLFTEPLSIEKIKQILQLTESGTEEIISTRSKAFQQLNVDINDLSLNELF
    DMITHDPSLLRRPIMLDEKRLQVGYNEDEIRRFLPRKIRTLELLRAQQLANM

    >gi|308181064|ref|YP_003925192.1| thioredoxin [Lactobacillus plantarum subsp. plantarum ST-III]
    MVAATTDKTFTTDTASGVTLTDFWATWCGPCRMQSPVVEQLADEMGDKVTFNKMDVDANPETASNFGIMSIPTLLVKKDG
    EVVDTLVGYHSKEQIQQTLAQYL

    >gi|308181106|ref|YP_003925234.1| thiol peroxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MQVLFHDQALDLVGEPLQDGDQLPKFKVFTTHDEKIKTKDLLGKPVLLSVMPDIDTRVCSIQTKKFNQQADKYPHVQFLA
    ISNNAVADQAGWCAKEGVKNLTVASDEELSFGYATNLYLPNNGTLTRAIYVADAAGKIVYHEIVPDVSHEPNYVAALDAL
    KQFE

    >gi|308181278|ref|YP_003925406.1| NADH peroxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MKVIVVGSSHGGYETVRGILAAQPDTEIQWYEKGDFLSFLSCGMQLYLEGAVKDVNSVSYATPAGMQAQGVHVFVNSEIS
    KVDPASHSVHVIDHATGDERDETYDKLVLSVGAVPFDLPVPGHDLANIYAMRGRDWAIKLKAKTVDPSVKNVVVIGSGYI
    GIEAAEVFAKAGMHVTVIDLLPRLLSLYLDQEFTDILTKTMADHGIYAAVGQGIKAYEGVDGHVTKVVTDQGEYPADLVV
    TAAGIRPATGFLKGVVDLDDHGLIKINDHLQTSDTDIYAVGDATLVPFAPTGKDNRIALATNARRQGRIAAKNLLGENVP
    MPAVSGSSALSVFDYHFASTGVKEGTADKLGVKTASVLVTDTIRPKFVSEDAGNTKVWFKLTFDPTDGRVLGAQIMSKYD
    VTANINAISVAIQAKLTVADLAYTDFFFQPGFDRPWNIINVAAQKAAATLN

    >gi|308181345|ref|YP_003925473.1| thioredoxin H-type [Lactobacillus plantarum subsp. plantarum ST-III]
    MATATLSDEEIRKRIKTGKHMLFFTADWCPDCAFIKPVMPQIEAKYDQYDWITVDRDANIEIAQDMGVMGIPSFVGIEDG
    QEIGRYVDKFRKTQKQVEDFLDTLEK

    >gi|308181517|ref|YP_003925645.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Lactobacillus plantarum subsp. plantarum ST-III]
    MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTG
    TPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGQNPLLIVIP
    CHRIRRKDGQLGGYRGGLPMKRALLALE
    NARLPK

    >gi|308181867|ref|YP_003925995.1| glutathione reductase [Lactobacillus plantarum subsp. plantarum ST-III]
    MTNKYDYDVLYIGAGHATFDGAAPLAKTGVRVGVIESGLIGGTCPNRGCNAKITLDEPVKLTREAARLNDILSSAPTINW
    TANVAHKQEIIDPLPAGLTARLEDGGATIIHGHATFKDAHTVVVDDQQTITAEKIVIATGLKPHRLDIPGTKLAHDSSDF
    MNLKRLPQSIVIIGAGYIGMEFATIANAAGAQVTVMLHGDQALRDFYQPFVTQVVDDLTERGVTFIKNANVQAFTKQDDQ
    FQVSYGDHQQLTTDWILDATGRIPNLDGLGLDQIGVKYDRHGVYVNDHLQTNVPNIYAAGDVLANDLPKVTPAAYFESKY
    LMRLFSGQTSAPIDYPVIPSVVFTSPRIAQAGMKIPAAEKAGLTISDNDLADYWYYQVSKEPIAASKQVHDQDGHLVGVT
    EISDQAEDAVNALLPAIEYQLDREQIDRLIGIFPTIGYAAWHRA

    >gi|308181992|ref|YP_003926120.1| thioredoxin [Lactobacillus plantarum subsp. plantarum ST-III]
    MIKEIHDQDFAKETDTGIAVIDFRADWCPPCRMMDPILKSLSEDPAYKDQVNFVSLNIDHDQATASQFQVQGIPTFLIKK
    DGQVVSHMVGARPKPDFETELKKVLA

    >gi|308181996|ref|YP_003926124.1| hypothetical protein LPST_C2819 [Lactobacillus plantarum subsp. plantarum ST-III]
    MIMKIIMQLGTLTCPSCMTKIEKAVANHDGVENVKVLFNASKVKANFDPEVTNADDLAQVVTGLGYEVENVKVK

    >gi|308182002|ref|YP_003926130.1| NADH oxidase [Lactobacillus plantarum subsp. plantarum ST-III]
    MKVIVIGCTHAGTAAVNQILASNPDTEVTIYERNDNVSFLSCGIALYLGGQVADPQGLFYSSPEQLAKLGATVHMQHDVT
    DVNTDKHEITVTDLKTGESKTDHYDKLVVTTGSWPVIPPIDGIDSPNVYL
    CKNWTHAQNLWEAAKPAKRVIVIGGGYIGT
    ELVEAYQKQGKEVTLIDGLPRILNKYLDKEFTDRVEQDFVDHGIKMALNQMVQGFSDDGKEVTVKTDKGSYTADMAILCV
    GFRPNTGLLKGKVDMNANGSIKTNDYMQTSDPDIYGAGDSVAVHYNPTKKDAYIPLATNAVRQGTLVGLNIFKPTRKYMG
    TQSTSGLMLFGQTIVSSGMTLEHAQAENVPAAAVTFEDNYRPEFMPTTKPVLMQLVYNPETREILGAQFMSEHDVSQSAN
    VISVMIQNHNTIDDLGFVDMFFQPIYDRPFNYLNLLGQAAIAHAAEAVTE

    >gi|308182101|ref|YP_003926229.1| negative regulator of proteolysis [Lactobacillus plantarum subsp. plantarum ST-III]
    MIRLYTQSSCHSSRVARQWLEAHGIEFKEKNFSVDSPTVQDLKRILSLTEHGVDDIISARSKDYPEIAPKLPEMPLNEAL
    KLLCDHPKLLRRPIIISDSKIQVGFNEDDIRQFIPRPVRRLKFNALLSRLDGNTGDYIINKRMVE