Lactobacillus plantarum JDM1 uid59361

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254555373|ref|YP_003061790.1| glutathione peroxidase [Lactobacillus plantarum JDM1]
    MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVVLGLPSNQFHQEKADDDETHD
    YCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIKWNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSE
    D

    >gi|254555388|ref|YP_003061805.1| thioredoxin [Lactobacillus plantarum JDM1]
    MIEPVDKTTFATVADGTALTVVDFWADWCGPCKMQEPVLEALDELYDGQVKFASLDVDQHQEIAQQFEIMSIPALVIFKN
    GQPAEKVVGFHPQAALKKYLDQKLAEVKPA

    >gi|254555500|ref|YP_003061917.1| glutathione reductase [Lactobacillus plantarum JDM1]
    MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWP
    ALMAHKRGYTDGINDGTLNGLKGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLD
    LDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQ
    LTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVG
    ELTHPGAAIKYSVVPTQVFAAPKLAQVGISAAAATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATL
    LSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY

    >gi|254555736|ref|YP_003062153.1| glutaredoxin-like protein NrdH [Lactobacillus plantarum JDM1]
    MKKVTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLKNQGFHAVPVVEINGEDSIAGFRPDALKQLAV

    >gi|254555796|ref|YP_003062213.1| NADH oxidase [Lactobacillus plantarum JDM1]
    MKIVIVGCTHAGTAAAAQILKDHPEATVTIYERDDNISFLSCGIYLYLGGKVNHLEDMFYSSPETLAKLGAMVRTKHNVL
    KIDAQSKTLQVVDMTTGKVFGDTYDKLIMTTGSNVAVPPIFGIDESKVLLCKTYSQAQEIYQTAQDNQRIAIIGAGYIGT
    ELSESYANTHHEVTLFQSHDQILNNYISKEISDQAVQLLKDHGVNVLLNHQVTAFTGNDDGELVIETNQGDFNADLAIVG
    TGFVPKYGTVTRSS

    >gi|254555798|ref|YP_003062215.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum JDM1]
    MAKSYDVIIIGAGPAGMTAALYASRANLSVLLLDRGIYGGQMNNTAAIENYPGFKSVLGPDLAKDMYESATQFGAEYAYG
    SVESVEDRGDVKIVTTDSDTFETKALVIGTGSEYRKLGVTGEDTYGGRGVSY
    CAVCDGAFFRNKHVVVVGGGDSAIEEGT
    YLTQLADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKTGEDSEIAVDGVFIYVGIN
    PITKPFSNLGITDENGWIETNDHMETKVPGIFAVGDVRKKDLRQVATAVGEGGTAGQGVYTYITALGDKVNN

    >gi|254555803|ref|YP_003062220.1| NADH oxidase [Lactobacillus plantarum JDM1]
    MKVAIIGCTHAGIAAMKQILKYYPGTEITVYERHADISYMSCGTYLHLGGTIHNLDQALYANPSEFSEQGVQMRMQYDVI
    NVNADKHTILAQNLQTKELQTDHYDKLVMATGSITAIPAIPGVENPKVML
    CKTCEQAQQLYEAAKHAHHIAIVGGGYSGV
    ELAEGYVKSGHTVTLFQRGPHLINEYLDPQISEKIEDLLTTKGIQVRTNAQVTAFSDTADNRLRVATADSEEIFDMAVIC
    PGVIPQSELLAGQVNRTKQGAIVTDRYMGTSNPDIFAAGDVTEVNFNPTKEHAYMPLVSHAIRQGALAGINIFDKRLGAI
    GTQATTGMLIFDQTVACAGLTLTAAKAANFDAQAAFYEGNYRPDFMPTTAKVMIELVYDQQTRKVLGGQLMSAHEVSQSA
    NTLSVVIHNGNTIDELAFMDMLFSPNFDEPFNYLNLVAQAAVDQEHGYRRNN

    >gi|254555883|ref|YP_003062300.1| redox protein, regulator of disulfide bond formation (putative) [Lactobacillus plantarum JDM1]
    MSDFPILYTTQAVNEDGIEGHAYIPNGLEVAVSSPLKAVPGSNPEQLIGLALSTCLNATLEAIEKEHGQTHQSKVVTTVK
    MSRDRFRYQFFLDARVTIPEVDAETAARWLAIAETR
    CPVAKLVGPSANVTIQLA

    >gi|254556227|ref|YP_003062644.1| glutathione reductase [Lactobacillus plantarum JDM1]
    MSEKFDVVYLGSGHGTFDGAIPLAARGKKVAVIEADLIGGTCPNRGCNAKITLDQPVALKNQVANFQGYGLRGEPTIDWQ
    ANFDHERDVIAGLPDMIAGLMTSAGVTLINGRGTFVDDHTIQVADKTYTADKIVIATGQHPHRLDIPGTELAHDSNDFLN
    LTTLPHHITVIGAGYIGLEFANMALTAGSQVTLLMRGDQALRQFHQPFVERLLAILVEQGLVLKREWVPTAIKSTGDHFE
    VLSADDKVTTDWILDATGRQPNTANLGLEKIGVDYTAAGITVDDHLQTSVAGIYASGDVLAKDQPKLTPTAIFESQYLTH
    LFMGDTNAPIKYPAIPSVVFTSPRLAQVGTLPTSDTHDIKVTVNDLKDDWFRQTTRDVTGHNLLVTDDQHRLIGAAELGE
    QAENTINTLLPAIQYQLTPAQREQLVTLFPSIGAAVWSAI

    >gi|254556299|ref|YP_003062716.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum JDM1]
    MKTKPEALMRDLYNLIINPATRDWERHLLVQAKNNRQQLSPTGQLKQLEADLRPLAMRNNLTPDVMDFYLAITGNAPMPT
    KNNVSAYPTLSSPYEERAVFAGG
    CFWCMVEPFDQRPGINNVISGYTGGSWAQPTYEQVSGQYTGHVEAVEIRYDSRKISY
    QNLVDIYWQLIDPTDRFGQINDRGSQYRPVIFYANQHQLTIAQASKQALVDSQRYQKPIVVAIEPLQQFWPAENYHQDFY
    RKQPRRYRQLKKAHDHYLNWLKFKNKF

    >gi|254556419|ref|YP_003062836.1| molybdopterin biosynthesis protein MoeB [Lactobacillus plantarum JDM1]
    MLNRYDRQERVTVIGHDGQRRINAATILIVGVGALGSYAAEQLVRAGVGHLILVDPDTVSLTNLQRQALFTEADVRDQAL
    KVDAAKNHLQAINHHVEITAYPAALDGDLLQTLTFDLVLDCLDNYGTRILINRAALVERFDYIFASCAGTFGTVMPIRAW
    QHACLNCVYHNLEALQQTD
    CDLLGVNTALVPIIAGLQVSLALHYLVAPTSVDFEQLTTIDNWQLSQQTFHVRKNPNCPTC
    QRTDWDLTTAPITNPVQVLCGTATYQARFTQKPNLAAITDWLLDRQFSIKSYASFISFKWEDRPISIFKNGKVMLYNIPD
    LDAATATFNRLQLYLKSVLEVPIK

    >gi|254556702|ref|YP_003063119.1| glutathione reductase [Lactobacillus plantarum JDM1]
    MADYDTIFIGSGHATWHAAVTLARAQQKVAIIEEDTIAGTCTNFGCDAKILLDGPFELTEQLKQYQGIGVNTTPSIDWSQ
    LMAYKQQVIRPLSVQMTAVFKQLGIKIITGHGELTDTHTVQVAGSTYTADTIVVGTGQRPAKLAIPGADLMHDSRDFLDL
    PTMPKRLTLIGAGIISLEFANMAVLLGSEVHIIEFADRALPAFYSEHVEKMIAHLQAAGVHFHFGEALSQVTKSATGLLA
    TTKNGLTIESDDIITATGRIPNIEHLGLTKVGIKTDRHGIIVDDHLQTNIPNIYASGDVISKTLPKLTPTATFESNYIAG
    QLLGSTAAIDYPVIPAVVFTLPRIAQVGIPVEAAKLDTEHFHVQALPYGKLLAFQYQNEVDADLQLVFDQENYLVGASIY
    GNGAPDLINLLTMIITDHVSANTLSQKIFAFPSASAGIIDMLTPLLHHD

    >gi|254556710|ref|YP_003063127.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum JDM1]
    MTETAIFAGGCFWCMVKPFDQQPGIKSVISGYTGGTVANPTYEQVASHTTGHTEAVKITFDPDVISYADLVEIYWRQTDP
    TDASGQFQDRGDSYRPVIFVNSEAQRRTATASRDALAASGKFAEPIVTTIEDAKPFYPAEAEHQDFYRRNPFRYQIEEMG
    GREAFIKQHWQ

    >gi|254556711|ref|YP_003063128.1| methionine sulfoxide reductase B [Lactobacillus plantarum JDM1]
    MDKQQGELRQRLTPEQYAVTQEAATERPFSGEYDNFYQEGIYVDVVSGQALFSSRDKYDAGCGWPSFTKPIDQTNLNEHR
    DESFGMHRTEVTSTQANSHLGHVFPDGPRDRGGLRY
    CINSAALKFIPVADLEKAGYGQYQSLFK

    >gi|254556785|ref|YP_003063202.1| NADH oxidase (putative) [Lactobacillus plantarum JDM1]
    MAENVLNDEFKQVAVTQVRQLVLAGAFIIDAREPQEYADGHIKGAHNIPLSQFRQRLVEIPTNQPVYIHCQTGQRSYNMV
    RALLQRGYTNVVNIAGSYAELVQYEYFNDQTTGRTSILTRT

    >gi|254556786|ref|YP_003063203.1| NADH oxidase (putative) [Lactobacillus plantarum JDM1]
    MKVKKVVIVGGVGGGASAAARVRRLDEFAQITIFEKGPDVSFSNCALPYTFSDVIDQPDDVILKTPMQFEQQYNIDVQVN
    TTVVAIDAQAKTVMIKRQGQVATTIVPYDTLILSPGARPILPAVIAGIDRPNVKTVRNVQDVRTIQAYLTEQHVHDVTIV
    GGGFIGLEMAENLQQAGYQITIIEAAEHVLGTLDDEFAQLVHKELYDYGVQVILQEQVTAIGATQVQLASGRAVTSQLVI
    VAIGVTPVTELAVQAGCALGVTGGIKVDHRYQTSVADIYAVGDAIEVTNRLTRQSTRLALAFPAQMQARHMVDHLYGRTP
    QYGSVPPKMSSTWLAWWRKTS

    >gi|254556789|ref|YP_003063206.1| negative regulator of proteolysis [Lactobacillus plantarum JDM1]
    MIKLFTQAGCNSSRKARQWFRDHDIAFEEKNFSSAAPTVSELKQILCLTENGLEDIISTRSQSYPAIADKLPDMSFNETL
    RLLCEQPQLLRRPIIVGRNKLQVGFNDDDIRQFIPRHIRRLNFQQTLVGLVDM

    >gi|254556836|ref|YP_003063253.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum JDM1]
    METAIFAGGCFWCMVQPFDSQPGIDSVVSGYTGGHTKNPTYEDVKAHTTGHTEAVKITFDPDIISYTELVNIYWHQTDPT
    DAMGQFQDRGDNYRPVIFVNGPEQRRIAEASKRALQVSERFSKPIVTAIEDAKPFYPAEARHQRFYKNNPVVFAEQEAGG
    RADFIAEQWADAPKVD

    >gi|254556969|ref|YP_003063386.1| dihydrolipoamide dehydrogenase [Lactobacillus plantarum JDM1]
    MVVGDFAEERDTMIIGAGPGGYVAAIRAAELGQKVTVVEKEYIGGVCLNVGCIPSKALISAGHRLQEAKDSKIFGIKNIQ
    DPVLDFKVTQDWKDHQVVDRLTGGVEMLLKKHKVEVVRGEAYMHDNHTLRVMNGDHTGQTYKFKHLIIATGSRPVEIPGF
    KFSGRVVDSTGGLNLPEVPKELVVIGGGYIGSELAGAYANLGAHVTILEGTPQILPNFEKDMVKLVLNSFKKKGVDVITN
    AMAKNSEQDDSGVTVTYAVDGKETEIHADYVMVTVGRRPNTDDMGLEYTDVKLTKRGLIEVDEQGRTAAEDIFAIGDIVA
    GAALAHKAFAEAKVAAGAISGKKTANDYVSIPAVCFTDPELATVGMTKAEAEEAGLQVKTSKFPFAGNGRAISLNAMDGF
    FRLVSTKDEGTIVGAQIAGPGASDLISELSVAVNGGMNVEDLALTIHPHPTLGEVVQEAADEAMGYPTHI

    >gi|254557032|ref|YP_003063449.1| negative regulator of proteolysis [Lactobacillus plantarum JDM1]
    MVILYTAPSCTSCRKAKAWLQTHDIDFQEHNLFTEPLSIEKIKQILQLTESGTEEIISTRSKAFQQLNVDINDLSLNELF
    DMITHDPSLLRRPIMLDEKRLQVGYNEDEIRRFLPRKIRTLELLRAQQLANM

    >gi|254557070|ref|YP_003063487.1| thioredoxin [Lactobacillus plantarum JDM1]
    MVAATTDKTFTTDTASGVTLTDFWATWCGPCRMQSPVVEQLADEMGDKVTFNKMDVDANPETASNFGIMSIPTLLVKKDG
    EVVDTLVGYHSKEQIQQTLAQYL

    >gi|254557110|ref|YP_003063527.1| thiol peroxidase [Lactobacillus plantarum JDM1]
    MQVLFHDQALDLVGEPLQDGDQLPKFKVFTTHDEKIKTKDLLGKPVLLSVMPDIDTRVCSIQTKKFNQQADKYPHVQFLA
    ISNNAVADQAGWCAKEGVKNLTVASDEELSFGYATNLYLPNNGTLTRAIYVADAAGKIVYHEIVPDVSHEPNYIAALDAL
    KQFE

    >gi|254557215|ref|YP_003063632.1| NADH peroxidase [Lactobacillus plantarum JDM1]
    MKVIVVGSSHGGYETVRGILAAQPDTEIQWYEKGDFLSFLSCGMQLYLEGAVKDVNSVSYATPAGMQAQGVHVFVNSEIS
    KVDPASHSVHVIDHVTGDERDETYDKLVLSVGAVPFDLPVPGHDLANIYAMRGRDWAIKLKAKTVDPSVKNVVVIGSGYI
    GIEAAEVFAKAGMHVTVIDLLPRLLSLYLDQEFTDILTKTMADHGIYAAVGQGIKAYEGVDGHVTKVVTDQGEYPADLVV
    TAAGIRPATGFLKGVVDLDDHGLIKINDHLQTSDTDIYAVGDATLVPFAPTGKDNRIALATNARRQGRIAAKNLLGENVP
    MPAVSGSSALSVFDYHFASTGVKEGTADKLGVKTASVLVTDTIRPKFVSEDAGNTKVWFKLTFDPTDGRVLGAQIMSKYD
    VTANINAISVAIQAKLTVADLAYTDFFFQPGFDRPWNIINVAAQKAAATLN

    >gi|254557279|ref|YP_003063696.1| thioredoxin H-type [Lactobacillus plantarum JDM1]
    MATATLSDEEIRERIKTGKHMLFFTADWCPDCAFIKPVMPQIEAKYDQYDWITVDRDANIEIAQDMGVMGIPSFVGIEDG
    QEIGRYVDKFRKTQKQVEDFLDTLEK

    >gi|254557452|ref|YP_003063869.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Lactobacillus plantarum JDM1]
    MHLTLTQTTINQQTYWLGTTPAGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTG
    TPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGKNPLLIVIP
    CHRIRRKDGQLGGYRGGLPMKRALLALE
    NARLPK

    >gi|254557786|ref|YP_003064203.1| glutathione reductase [Lactobacillus plantarum JDM1]
    MTNKYDYDVLYIGAGHATFDGAAPLAKTGVRVGVIESGLIGGTCPNRGCNAKITLDEPVKLTREAARLNDILSSAPTINW
    TANVAHKQEIIDPLPAGLTARLEDGGATIIHGHATFKDAHTVVVDDQQNITAEKIVIATGLKPHRLDIPGTKLAHDSSDF
    MNLKRLPQSIVIIGAGYIGMEFATIANAAGAQVTVMLHGDQALRDFYQPFVAQVVDDLTERGVTFIKNANVQAFTKQDDQ
    FQVSYGDHQQLTTDWILDATGRIPNLDGLGLDRIGVKYDHHGVYVNDHLQTNVPNIYAAGDVLANDLPKVTPAAYFESKY
    LMRLFSGQTSAPIDYPVIPSVVFTSPRIAQAGMKIPAAEKAGLTVSDNDLADYWYYQVSKEPIAASKQVHDQDGHLVGVT
    EISDQAEDAVNALLPAIEYQLDREQIDRLIGIFPTIGYAAWHRA

    >gi|254557905|ref|YP_003064322.1| thioredoxin [Lactobacillus plantarum JDM1]
    MIKEIHDQDFAKETDTGIAVIDFRADWCPPCRMMDPILKSLSEDPAYKDQVNFVSLNIDHDQATASQFQVQGIPTFLIKK
    DGQVVSHMVGARPKPDFEAELKKALA

    >gi|254557909|ref|YP_003064326.1| hypothetical protein JDM1_2743 [Lactobacillus plantarum JDM1]
    MIMKIIMQLGTLTCPSCMTKIEKAVANHDGVENVKVLFNASKVKANFDPEVTNADDLAQVVTGLGYEVENVKVK

    >gi|254557914|ref|YP_003064331.1| NADH oxidase [Lactobacillus plantarum JDM1]
    MKVIVIGCTHAGTAAVNQILASNPDTEVTIYERNDNVSFLSCGIALYLGGQVADPQGLFYSSPEQLAKLGATVHMQHDVT
    DVNTDKHEITVTDLKTGESKTDHYDKLVVTTGSWPVIPPIAGIDSPNVYL
    CKNWTHAQNLWEAAKPAKRVIVIGGGYIGT
    ELVEAYQKQGKEVTLIDGLPRILNKYLDKEFTDRVEQDFVDHGIKMALNQMVQGFSDDGKEVTVKTDKGSYTADMAILCV
    GFRPNTGLLKGKVDMNANGSIKTNDYMQTSDPDIYGAGDSVAVHYNPTKKDAYIPLATNAVRQGTLVGLNIFKPTRKYMG
    TQSTSGLMLFGQTIVSSGMTLEHAQAENVPAAAVTFEDNYRPEFMPTTKPVLMQLVYNPETREILGAQFMSEHDVSQSAN
    VISVMIQNHNTIDDLGFVDMFFQPIYDRPFNYLNLLGQAAIAHAAEAVTE

    >gi|254558026|ref|YP_003064443.1| negative regulator of proteolysis [Lactobacillus plantarum JDM1]
    MIRLYTQSSCHSSRVARQWLEAHGIEFKEKNFSVDSPTVQDLKRILSLTEHGVDDIISARSKDYPEIAPKLPEMPLNEAL
    KLLCDHPKLLRRPIIISDSKIQVGFNEDDIRQFIPRPVRRLKFNALLSRLDGNTGDHIINKRMVE

    >gi|254556804|ref|YP_003063221.1| NADH oxidase [Lactobacillus plantarum JDM1]
    MKVMIIGSTHAGTAAAREILTRHPETAVTIYERNDNVSFVSSGIYLYLTGVIQHLEDMFYTSPADLKQLGAQVKTRHNVL
    RIDTGHKTVQVANMQTGEVFDDTYDKLIMATGSSVIVPPIMGIDHEKVLL
    CKNYEQAEQLYQSLQANQRVAIVGAGYMGT
    ELAESYASMDQQVMLFHSHSHILNNYLGPQMADAATKLLQHHQVDIHLNERVTGFASGSNDQLIVETAQGDYEVDLAVVC
    AGFMPNTELLRGQVAMDRHGAILINDYVQTSDPDIYAAGDACVVNYNPTGQPAYTPLATNALRQGALAGINVFGDLQPYM
    GTQATSAMQLFDHTMATTGLTYPAAQRRELPVRHAVYQGNWRPSYMPTTAKVTIELVYNYQNRQLLGAQFWSRHDIAQAA
    NTISVMIQNQNTIDDLAYVDMFFQPNFNQPFNYLNLVGQLAVQQEYQRGNQTPRITARGNWSNSSDKH