Lactobacillus plantarum

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28377153|ref|NP_784045.1| glutathione peroxidase [Lactobacillus plantarum WCFS1]
    MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVVLGLPSNQFHQEKADDDETHD
    YCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIKWNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSE
    D

    >gi|28377165|ref|NP_784057.1| thioredoxin [Lactobacillus plantarum WCFS1]
    MIEPVDKTTFATVADGTALTVVDFWADWCGPCKMQEPVLEALDELYDGQVKFASLDVDQHQEIAQQFEIMSIPALVIFKN
    GQPAEKVVGFHPQAALKKYLDQKLAEVKPA

    >gi|28377284|ref|NP_784176.1| glutathione reductase [Lactobacillus plantarum WCFS1]
    MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWP
    ALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLD
    LDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQ
    LTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVG
    ELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATL
    LSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY

    >gi|28377563|ref|NP_784455.1| glutaredoxin-like protein NrdH [Lactobacillus plantarum WCFS1]
    MKKVTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLKNQGFHAVPVVEINGEDSIAGFRPDALKQLAV

    >gi|28377618|ref|NP_784510.1| NADH oxidase [Lactobacillus plantarum WCFS1]
    MKIVIVGCTHAGTAAAAQILKDHPEATVTIYERDDNISFLSCGIYLYLGGKVNHLEDMFYSSPETLAKLGAMVRTKHNVL
    KIDAQSKTLQVVDMTTGKVFGDTYDKLIMTTGSNVAVPPIFGIDESKVLL
    CKTYSQAQEIYQTAQDNQRIAIIGAGYIGT
    ELSESYANTHHEVTLFQSHDQILNNYISKEISDQAVQLLKDHGVNVLLNHQVTAFTGNDDGELVIETNQGDFNADLAIVG
    TGFVPNTELLRGQVEMDKHGAIIINDYVQTSDPDIYAAGDSCVVNFNPTGRSAYTPLATNAVRQGALAGANVFGNQQRYM
    GTQATSAMQLFDHTLATTGLTLAMAKLNHIPAERVTYEGNWRPAYMPSTAKLTIELIYNPENRKILGAQFLSAHEVAQSA
    NALSIAIQNGNTIDDLAFVDMLFSPNFDEPFNYLNLVAQQAIEQERQAGRNHPRITAYGDWAKQNDKDLQ

    >gi|28377619|ref|NP_784511.1| thioredoxin reductase (NADPH) [Lactobacillus plantarum WCFS1]
    MAKSYDVIIIGAGPAGMTAALYASRANLSVLLLDRGIYGGQMNNTAAIENYPGFKSVLGPDLAKDMYESATQFGAEYAYG
    SVESVEDRGDVKIVTTDSDTFETKALVIGTGSEYRKLGVTGEDTYGGRGVSY
    CAVCDGAFFRNKHVVVVGGGDSAIEEGT
    YLTQLADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKTGEDSEIAVDGVFIYVGIN
    PITKPFSNLGITDENGWIETNDHMETKVPGIFAVGDVRKKDLRQVATAVGEGGTAGQGVYTYITALGDKVNN

    >gi|28377624|ref|NP_784516.1| NADH oxidase [Lactobacillus plantarum WCFS1]
    MKVAIIGCTHAGIAAMKQILKYYPGTEITVYERHADISYMSCGTYLHLGGTIHNLDQALYANPSEFSEQGVQMRMQYDVI
    NVNADKHTILAQNLQTKELQTDHYDKLVMATGSITAIPAIPGVENPKVML
    CKTCEQAQQLYEAAKHAHHIAIVGGGYSGV
    ELAEGYVKSGHTVTLFQRGPHLINEYLDPQISEKIEDLLTTKGIQVRTNAQVTAFSDTADNRLRVATADSEEIFDMAVIC
    PGVIPQSELLAGQVNRTKQGAIVTDRYMGTSNPDIFAAGDVTEVNFNPTKEHAYMPLVSHAIRQGALAGINIFDKRLGAI
    GTQATTGMLIFDQTVACAGLTLTAAKAANFDAQAAFYEGNYRPDFMPTTAKVMIELVYDQQTRKVLGGQLMSAHEVSQSA
    NTLSVVIHNGNTIDELAFMDMLFSPNFDEPFNYLNLVAQAAVDQEHGYRRNN

    >gi|28377699|ref|NP_784591.1| redox protein, regulator of disulfide bond formation (putative) [Lactobacillus plantarum WCFS1]
    MEELRLSDFPILYTTQAVNEDGIEGHAYIPNGLEVAVSSPLKAVPGSNPEQLIGLALSTCLNATLEAIEKEHGQRHQSKV
    VTTVKMSRDRFGYQFFLDARVTIPEVDAETAARWLAIAETR
    CPVAKLVGPSANVTIQLA

    >gi|28378020|ref|NP_784912.1| glutathione reductase [Lactobacillus plantarum WCFS1]
    MSEKFDVVYLGSGHGTFDGAIPLAARGKKVAVIEADSIGGTCPNRGCNAKITLDQPVALKNQVANFQGYGLRGEPTIDWQ
    ANFDHERDVIAGLPDMIAGLMTSAGVTLINGRGTFVDDHTIQVADKTYTADKIVIATGQHPHRLDIPGTELAHDSNDFLN
    LTTLPHHITVIGAGYIGLEFANMALTAGSQVTLLMRGDQALRQFHQPFVERLLAILVEQGLVLKREWVPTAIKSTGDHFE
    VLSADDKVTTDWILDATGRQPNTANLGLEKIGVDYTAAGITVDDHLQTSVAGIYASGDVLAKDQPKLTPTAIFESQYLTH
    LFMGDTNAPIKYPAIPSVVFTSPRLAQVGTLPTSDTHDIKVTVNDLKDDWFRQTTRDVTGHNLLVTDDQHRLIGAAELGE
    QAENTINTLLPAIQYQLTPAQREQLVTLFPSIGAAVWSAI

    >gi|28378084|ref|NP_784976.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum WCFS1]
    MKTKPEALMRDLYNLIINPATRDWERHLLVQAKNNRQQLSPTGQLKQLEADLRPLAMRNNLTPDVMDFYLAITGNAPMPT
    KNNVSAYPTLSSPYEERAVFAGG
    CFWCMVEPFDQRPGINNVISGYTGGSWAQPTYEQVSGQYTGHVEAVEIRYDSRKISY
    QNLVDIYWQLIDPTDRFGQINDRGSQYRPVIFYANQHQLTIAQASKQALVDSQRYQKPIVVAIEPLQQFWPAENYHQDFY
    RKQPRRYRQLKKAHDHYLNWLKFKNKF

    >gi|28378212|ref|NP_785104.1| molybdopterin biosynthesis protein MoeB [Lactobacillus plantarum WCFS1]
    MLNRYDRQERVTVIGHDGQRRINAATILIVGVGALGSYAAEQLVRAGVGHLILVDPDTVSLTNLQRQALFTEADVRDQAL
    KVDAAKNHLQAINHHVEITAYPAALDGDLLQTLTFDLVLDCLDNYGTRILINRAALVERFDYIFASCAGTFGTVMPIRAW
    QHACLNCVYHNLEALQQTD
    CDLLGVNTALVPIIAGLQVSLALHYLVAPTSVDFEQLTTIDNWQLSQQTFHVRKNPNCPTC
    QRTDWDLTTAPITNPVQVLCGTATYQARFTQKPNLAAITDWLLDRQFSIKSYASFISFKWEDRPISIFKNGKVMLYNIPD
    LDAATATFNRLQLYLKSVLEVPIK

    >gi|28378490|ref|NP_785382.1| glutathione reductase [Lactobacillus plantarum WCFS1]
    MADYDTIFIGSGHATWHAAVALAHAQHKVAIIEEDTIAGTCTNFGCDAKILLDGPFELTEQLKQYQGIGVNTTPTIDWSQ
    LMAYKQQVIQPLSVQMTAVFKQLGITIITGHGELTDTHTVQVADSTYTADTIVIGTGQRPAKLAIPGADLMHDSRDFLDL
    PTMPKRLTLIGAGIISLEFANMAVLLGSEVHIIEFADRALPAFYSEHVKKMITHLQAAGVHFHFGEALSQVTKTATGLMA
    TTASGLKIESDDIIAATGRIPNIEHLGLTKVGIKTDRHGIIVDDHLRTSIPNIYASGDVISKTLPKLTPTAIFESNYIAG
    QLLGSTAAIDYPVIPAVVFTLPRIAQVGVSVEAAQHDTEHFHVQALPYGKLLAFQYQNEVDADLQLVFDQENYLVGASIY
    GNGALDLINLLTMIIADHVSATTLSQKIFAFPSASVGIIDMLTPLLHHD

    >gi|28378496|ref|NP_785388.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum WCFS1]
    MTETAIFAGGCFWCMVKPFDQQPGIKSVISGYTGGTVANPTYEQVASHTTGHTEAVKITFDPDVISYADLVEIYWRQTDP
    TDASGQFQDRGDSYRPVIFVNSEAQRRTATASRDALAASGKFAEPIVTTIEDAKPFYPAEAEHQDFYRRNPFRYQIEEMG
    GREAFIKQHWQ

    >gi|28378497|ref|NP_785389.1| methionine sulfoxide reductase B [Lactobacillus plantarum WCFS1]
    MDKQQGELRQRLTPEQYAVTQEAATERPFSGEYDNFYQEGIYVDVVSGQALFSSRDKYDAGCGWPSFTKPIDQTNLNEHR
    DESFGMHRTEVTSTQANSHLGHVFPDGPRDRGGLRY
    CINSAALKFIPVADLEKAGYGQYQSLFK

    >gi|28378572|ref|NP_785464.1| NADH oxidase (putative) [Lactobacillus plantarum WCFS1]
    MEVKKVVIVGGVGGGASAAARVRRLDEFAQITIFEKGPDVSFSNCALPYTFSDVIDQPDDVILKTPMQFEQQYNIDVQVN
    TTVVAIDAQAKTVMIKRQGQVATTIVPYDTLILSPGARPILPAVIAGIDRPNVKTVRNVQDVRTIQAYLTEQHVHDVTIV
    GGGFIGLEMAENLQQAGYQITIIEAAEHVLGTLDDEFAQLVHKELYDHGVQVILQEQVTAIGATQVQLASGRAVTSQLVI
    VAIGVTPVTELAVQAGCALGVTGGIKVDHRYQTSVADIYAVGDAIEVTNRLTRQSTRLALAFPAQMQARHMVDHLYGRTP
    QYQGVIGSQVLHVFTLNVASTGLNATECEHQQLDYRFATVAPQNRVSVMPGTTAVFLKLIFSYPTGEILGAQAIGQSDVD
    KPIDIIASLITMHGRVSDLTDVELCYSPWVSTAKNVVNMVGLVAENVLNDEFKQVAVTQVRQLVLAGAFIIDAREPQEYA
    DGHIKGAHNIPLSQFRQRLVEIPTNQPVYIH
    CQTGQRSYNMVRALLQRGYTNVVNIAGSYAELVQYEYFNDQTTGRTSIL
    TRT

    >gi|28378575|ref|NP_785467.1| negative regulator of proteolysis [Lactobacillus plantarum WCFS1]
    MIKLFTQAGCNSSRKARQWFRDHDIAFEEKNFSSAAPTVSELKQILCLTENGLEDIISTRSQSYPAIADKLPDMSFNETL
    RLLCEQPQLLRRPIIVGRNKLQVGFNDDDIRQFIPRHIRRLNFQQTLVGLVDM

    >gi|28378621|ref|NP_785513.1| protein-methionine-S-oxide reductase [Lactobacillus plantarum WCFS1]
    METAIFAGGCFWCMVQPFDSQPGIDSVVSGYTGGHTKNPTYEDVKAHTTGHTEAVKITFDPDIISYTELVNIYWHQTDPT
    DAMGQFQDRGDNYRPVIFVNGPEQRRIAEASKRALQVSERFSKPIVTAIEDAKPFYPAEARHQRFYKNNPVVFAEQEAGG
    RADFIAEQWADAPKVD

    >gi|28378764|ref|NP_785656.1| dihydrolipoamide dehydrogenase [Lactobacillus plantarum WCFS1]
    MVVGDFAEERDTMIIGAGPGGYVAAIRAAELGQKVTVVEKEYIGGVCLNVGCIPSKALISAGHRLQEAKDSKIFGIKNIQ
    DPVLDFKVTQDWKDHQVVDRLTGGVEMLLKKHKVEVVRGEAYMHDNHTLRVMNGDHTGQTYKFKHLIIATGSRPVEIPGF
    KFSGRVVDSTGGLNLPEVPKELVVIGGGYIGSELAGAYANLGAHVTILEGTPQILPNFEKDMVKLVLNSFKKKGVDVITN
    AMAKNSEQDDSGVTVTYAVDGKETEIHADYVMVTVGRRPNTDDMGLEYTDVKLTKRGLIEVDEQGRTAAEDIFAIGDIVA
    GAALAHKAFAEAKVAAGAISGKKTANDYVSIPAVCFTDPELATVGMTKAEAEEAGLQVKTSKFPFAGNGRAISLNAMDGF
    FRLVSTKDEGTIVGAQIAGPGASDLISELSVAVNGGMNVEDLALTIHPHPTLGEVVQEAADEAMGYPTHI

    >gi|28378826|ref|NP_785718.1| negative regulator of proteolysis [Lactobacillus plantarum WCFS1]
    MVILYTAPSCTSCRKAKAWLQTHDIDFQEHNLFTEPLSIEKIKQILQLTESGTEEIISTRSKAFQQLNVDINDLSLNELF
    DMITHDPSLLRRPIMLDEKRLQVGYNEDEIRRFLPRKIRTLELLRAQQLANM

    >gi|28378864|ref|NP_785756.1| thioredoxin [Lactobacillus plantarum WCFS1]
    MVAATTDKTFTTDTASGVTLTDFWATWCGPCRMQSPVVEQLADEMGDKVTFNKMDVDANPETASNFGIMSIPTLLVKKDG
    EVVDTLVGYHSKEQIQQTLAQYL

    >gi|28378905|ref|NP_785797.1| thiol peroxidase [Lactobacillus plantarum WCFS1]
    MQVLFHDQALDLVGEPLQDGDQLPKFKVFTTHDEKIKTKDLLGKPVLLSVMPDIDTRVCSIQTKKFNQQADKYPHVQFLA
    ISNNAVADQAGWCAKEGVKNLTVASDEELSFGYATNLYLPNNGTLTRAIYVADAAGKIVYHEIVPDVSHEPNYVAALDAL
    KQFE

    >gi|28379083|ref|NP_785975.1| NADH peroxidase [Lactobacillus plantarum WCFS1]
    MKVIVVGSSHGGYETVRGILAAQPDTEIQWYEKGDFLSFLSCGMQLYLEGAVKDVNSVSYATPAGMQAQGVHVFVNSEIS
    KVDPASHSVHVIDHATGDERDETYDKLVLSVGAVPFDLPVPGHDLANIYAMRGRDWAIKLKAKTVDPSVKNVVVIGSGYI
    GIEAAEVFAKAGMHVTVIDLLPRLLSLYLDQEFTDILTKTMADHGIYAAVGQGIKAYEGVDGHVTKVVTDQGEYPADLVV
    TAAGIRPATGFLKGVVDLDDHGLIKINDHLQTSDTDIYAVGDATLVPFAPTGKDNRIALATNARRQGRIAAKNLLGENVP
    MPAVSGSSALSVFDYHFASTGVKEGTADKLGVKTASVLVTDTIRPKFVSEDAGNTKVWFKLTFDPTDGRVLGAQIMSKYD
    VTANINAISVAIQAKLTVADLAYTDFFFQPGFDRPWNIINVAAQKAAATLN

    >gi|28379150|ref|NP_786042.1| thioredoxin H-type [Lactobacillus plantarum WCFS1]
    MATATLSDEEIRERIKTGKHMLFFTADWCPDCAFIKPVMPQIEAKYDQYDWITVDRDANIEIAQDMGVMGIPSFVGIEDG
    QEIGRYVDKFRKTQKQVEDFLDTLEK

    >gi|28379318|ref|NP_786210.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Lactobacillus plantarum WCFS1]
    MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTG
    TPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGQNPLLIVIP
    CHRIRRKDGQLGGYRGGLPMKRALLALE
    NARLPK

    >gi|28379636|ref|NP_786528.1| glutathione reductase [Lactobacillus plantarum WCFS1]
    MTNKYDYDVLYIGAGHATFDGAAPLAKTGVRVGVIESGLIGGTCPNRGCNAKITLDEPVKLTRETARLNDILSSAPTINW
    TANVAHKQEIIDPLPAGLTARLEDGGATIIHGHATFKDAHTVVVDDQQTITAEKIVIATGLKPHRLDIPGTKLAHDSSDF
    MNLKRLPQSIVIIGAGYIGMEFATIANAAGAQVTVMLHGDQALRDFYQPFVAQVVDDLTERGVTFIKNANVQAFTKQDDQ
    FQVSYGDHQQLTTDWILDATGRIPNLDGLGLDRIGVKYDRHGVYVNDHLQTNVPNIYAAGDVLANDLPKVTPAAYFESKY
    LMRLFSGQTSAPIDYPVIPSVVFTSPRIAQAGMKIPAAEKAGLTVSDNDLADYWYYQVSKEPIAASKQVHDQDGHLVGVT
    EISDQAEDAVNALLPAIEYQLDREQIDRLIGIFPTIGYAAWHRA

    >gi|28379765|ref|NP_786657.1| thioredoxin [Lactobacillus plantarum WCFS1]
    MIKEIHDQDFAKETDTGIAVIDFRADWCPPCRMMDPILKSLSEDPAYKDQVNFVSLNIDHDQATASQFQVQGIPTFLIKK
    DGQVVSHMVGARPKPDFEAELKKALA

    >gi|28379768|ref|NP_786660.1| hypothetical protein lp_3442 [Lactobacillus plantarum WCFS1]
    MIMKIIMQLGTLTCPSCMTKIEKAVANHDGVENVKVLFNASKVKANFDPEVTNADDLAQVVTGLGYEVENVKVK

    >gi|28379772|ref|NP_786664.1| NADH oxidase [Lactobacillus plantarum WCFS1]
    MKVIVIGCTHAGTAAVNQILASNPDTEVTIYERNDNVSFLSCGIALYLGGQVADPQGLFYSSPEQLAKLGATVHMQHDVT
    DVNTDKHEITVTDLKTGESKTDHYDKLVVTTGSWPVIPPIDGIDSPNVYL
    CKNWTHAQNLWEAAKPAKRVIVIGGGYIGT
    ELVEAYQKQGKEVTLIDGLPRILNKYLDKEFTDRVEQDFVDHGIKMALNQMVQGFSDDGKEVTVKTDKGSYTADMAILCV
    GFRPNTGLLKGKVDMNANGSIKTNDYMQTSDPDIYGAGDSVAVHYNPTKKDAYIPLATNAVRQGTLVGLNIFKPTRKYMG
    TQSTSGLMLFGQTIVSSGMTLEHAQAENVPAAAVTFEDNYRPEFMPTTKPVLMQLVYNPETREILGAQFMSEHDVSQSAN
    VISVMIQNHNTIDDLGFVDMFFQPIYDRPFNYLNLLGQAAIAHAAEAVTE

    >gi|28379887|ref|NP_786779.1| negative regulator of proteolysis [Lactobacillus plantarum WCFS1]
    MIRLYTQSSCHSSRVARQWLEAHGIEFKEKNFSVDSPTVQDLKRILSLTEHGVDDIISARSKDYPEIAPKLPEMPLNEAL
    KLLCDHPKLLRRPIIISDSKIQVGFNEDDIRQFIPRPVRRLKFNALLSRLDGNTGDHIINKRMVE

    >gi|54307200|ref|YP_133730.1| NADH oxidase (putative) [Lactobacillus plantarum WCFS1]
    MANETEKLLIIGGSDAGISAALKAKELKPELKVQILLADEYPNLSICGIPYAVSGEVPDWHLLAHRNLQELTSTGIEFQM
    NMIADKIEPQRHEVVAHALTGELKTYHYDHLVVATGARPKLSGIKGVDLAQAQQQDSKVRILHTMADYFAIERNIATDSV
    RKVAIVGSGYIGIEMAEALRKRHLDVTIFQRGSEILSTVDADLGRIIHQKLSANAVNVITGLTVSEINETGSNVEVVGLN
    EHQKTQSSTYDLVLIVVGVQPNNELLVKVGAETGIAGAIEVDQYMQTSLPDIWAAGDLVETRHHLLGETYLPLGTTAHKQ
    GRIAGFNIAGIQRAFKGSLGTQVLKAFDLVVVRTGLLTSEAIQAGFNPFTVTTDVDDHKAYFPGAQKIKIRITGDQKSGR
    LLGVQLIGHYGSEVAKRSDIFATAIFNDMTVAEISDLDLSYSPPVGSPWDAVQIAAQNWEQQNAKR

    >gi|28378587|ref|NP_785479.1| NADH oxidase [Lactobacillus plantarum WCFS1]
    MKVMIIGSTHAGTAAAREILTRHPETAVTIYERNDNVSFVSSGIYLYLTGVIQHLEDMFYTSPSDLKQLGAQVKTRHNVL
    RIDTGHKTVQVANMQTGEVFDDTYDKLIMATGSSVIVPPIMGIDHEKVLL
    CKNYEQAEQLYQSLQANQRVAIVGAGYMGT
    ELAESYASMDQQVMLFHSHSHILNNYLGPQMADAATKLLQHHQVDIHLNERVTGFASGSNDQLIVETAQGDYEVDLAVVC
    AGFMPNTELLRGQVAMDRHGAILINDYVQTSDPDIYAAGDACVVNYNPTGQPAYTPLATNALRQGALAGINVFGDLQPYM
    GTQATSAMQLFDHTMATTGLTYLAAQRRELPVRHAVYQGNWRPAYMPTTAKVTIELVYNYQNRQLLGAQFWSRHDIAQAA
    NTISVMIQNQNTIDDLAYVDMFFQPNFNQPFNYLNLVGQLAVKQEYQRGNQTPRITARGNWSTSSDKH