Lactobacillus gasseri ATCC 33323 uid57687

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116628721|ref|YP_813893.1| glutathione reductase [Lactobacillus gasseri ATCC 33323]
    MKKYDYIILGTGPAAYQFIKLLATQRKSILVIESGLFGGTCPNVGCEPKIYLDGAVQAALLSRQLESHGIEQAATINWSQ
    LMKEKKERFASWPSETRKNISKICDVVSGSAHFIDQQTIAVNQRYFQGNKIIIATGRRPHELSIPGAKFLHDSSDVLSLN
    KVSEHVTFIGAGYVAMELATFLAAAGSQVTILVRGKHVLRHFYQKYSAELVTRMVQRGIQFKFATEATCITQLSDKYVVE
    LNQGSSLVTDYVVNASGRTSNIEKLDLSAAQIDYSPKGINVDQHLQTSVKNIYAIGDVTSQDVPNLTTVAEFQSHYLFNS
    LEKGLSQPINYPAIGTGVFAFPQLAQAGINPDSVSEDKDNFEIVEYELSQSSLYAGQKEKGLLTVVYDKANYIVGVSEIS
    TSAVNDVNYFVPIIGLRIRKNEWHQNVLPIYPALADKIEGILR

    >gi|116628920|ref|YP_814092.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus gasseri ATCC 33323]
    MKTISYYNSPIGKILLASDEQGLVGLWLDTDRYYGDILAKNYSEGENEYLVSAKKWLDIYFQGKEPTFTPQLHFTGTDFQ
    KRVWQALLKIPYGTTITYKKIAVQVAKDKEHLPIRATGGAVGRNHICIIVP
    CHRVVGVNHNLTGYAAGIDKKIKLLRLEG
    VDISQFKNHINH

    >gi|116629098|ref|YP_814270.1| Thiol-disulfide isomerase or thioredoxin [Lactobacillus gasseri ATCC 33323]
    MVDEITDATFEDETSEGVVLTDFWATWCGPCKMQSPVIDQLSEEMDDIKFTKMDVDQNQETARNLGIMAIPTLLIKKDGK
    IVDRLTGYTPKEKLEQILDQYTD

    >gi|116629401|ref|YP_814573.1| arsenate reductase [Lactobacillus gasseri ATCC 33323]
    MLKFYGYKRCSTSKKAQNWLDDHQIAYQYQDLVEKPPKQEELLKWLTDFQDRGLRYFFNTSGQVYRQMHLKDQINKMTLE
    EAAKLLSQNGKLIKRPLVTDGKKLACGFKEDIYEKTWL

    >gi|116629621|ref|YP_814793.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus gasseri ATCC 33323]
    MDKCKIVIVGASHGGHESAIELLDKYNDVDVTVYEAGDFISFMSCGMQLYLENKVTAEDDVRNFAPEDVEKKGGHVYANH
    EVTAIHPENKTVTVKDLTNNSEEEVQYDRLILSSGVTPKVLPVPGNDLKNIYLMRGRDWASKLMSAVNDPAIKNVAIVGA
    GYIGTEASEVFAKAGKHVTLMDMIDRPLGTYLNSELLDVLEPTFKKNMDLKMGVKIEGFNGNGKVESVKTDQGDVPADLV
    VVSAGVMPNTDWLKGVVDLDQRGWIKTDPYLRTNVKDVYAIGDAILPLSIPAGKPMPIALATTTRREAQYVVDHIFEDKP
    DRAFKGVIGASALSVFDYHFATAGLNQFSAAKNKLDYQTSFYEDNMRPAYVPEADNPKVYVSLTFNPYTHQILGGAVLSK
    YDITAQGNVLALAISHKMRLEDLAEQDFFFQPGFDRQWSLLNLAAQHALGMARF

    >gi|116629627|ref|YP_814799.1| copper chaperone [Lactobacillus gasseri ATCC 33323]
    MQKVMMKLGGMTCPSCLTKIEKAVEDVDGTDQIKVLFNAGKLKFMMNADKANVDDVKTAIEKMGYEVKGVKAKELD

    >gi|116629763|ref|YP_814935.1| peptide methionine sulfoxide reductase [Lactobacillus gasseri ATCC 33323]
    MEIIQNYSKLERSTNKMEVAKPLDNTKESHYDTAIFAGGCFWCMVEPFDTYPGIVSVVSGYTGGHVENPSYEEVCTGTTG
    HVEAVEITFDPKIISYKKLVDIYWQVTDPTDAMGQFQDRGSQYQPIIFYNSPQQKEIAEESKMQLEDSHRFDEPIVTKIE
    PAEPFYPAEDYHQDFYKKDPLRYQIEEAGGRAQFIEKHWKK

    >gi|116629765|ref|YP_814937.1| methionine sulfoxide reductase B [Lactobacillus gasseri ATCC 33323]
    MFKKEGEKMFNKEEALKKLNSEQYEVTQHAATEYPFTGKYDKFNQKGIYVDVVSGEPLFSSEDKYDAGCGWPSFTKPIEK
    LVYHRDQSHGMERTEVKSPLADSHLGHVFTDGPVDQGGLRY
    CINSAALKFIPYDKLEEEGYENYQKLFKGR

    >gi|116629795|ref|YP_814967.1| dithiol-disulfide isomerase [Lactobacillus gasseri ATCC 33323]
    MKMRISIWGDYACPYCYIGETYLQKAIKELGVEDKIEYDLNAFQIDLDAPKSTNNTNAALLAYEKAMPLSKANAAYDHAK
    VLGKEAGLTINEATAYNTNTMDAHRMVQWAKATYHDSKLTASLADDLFYAYFTENKELADHEVLLEIAKKNSLDLNEVKK
    LLESNDYQDVVMQEEADLQSRGIQSIPYFIIAGQQFDGVQDVSTFKTAIGAALGMKPGEFLNF

    >gi|116629953|ref|YP_815125.1| thioredoxin reductase [Lactobacillus gasseri ATCC 33323]
    MSERKNYDVIVIGAGPGGLTAALYAARANLKVVILDRGIYGGQMNNTAGIDNYPGFVDIQGPELGEKMYQTAMNAGAEFA
    YGDVQKIEQDGNQKIIKTDSGEYEAAAVVIATGAVHKHLGVAGEEEYAGKGVSY
    CAVCDAAFFRDEDVAVIGGGDSAIQE
    GLYLAQSAKSVTVIHRRDQLRAKAELQKKAFENDKMKFIWNAQTEEIVGDSNKVTAVKYKDKETGEEKEVKVAGVFIYVG
    IQPQTAAFKDLGITDEQGWILTDNNMRTKVKGIFALGDVRAKELRQIATAVGEGSIAGQEVYNYYQGLNEK

    >gi|116629987|ref|YP_815159.1| arsenate reductase [Lactobacillus gasseri ATCC 33323]
    MLNLYTSPSCTSCRKAKAWLKEHDISFKERNIFANPLNKEEIMQVLRMTENGTEEIISTRSRTFQNLKINLDDLSIDQLI
    DLVEKNPSLLRRPIIMDDRRLQVGYNEDEIRRFLPRKVRRLELEEIQAMTADL

    >gi|116630064|ref|YP_815236.1| Thiol-disulfide isomerase or thioredoxin [Lactobacillus gasseri ATCC 33323]
    MRRMEEIKELTPEKLKEITANGKVVLLFLATWCPDCRFLDPFLPQIEKDNSDAKFYKIDRDGSIDVAKELNIFGIPSFVV
    YQDGKEIGRLVNKDRKTKEEVENFLNSLK

    >gi|116630157|ref|YP_815329.1| rhodanese-related sulfurtransferase [Lactobacillus gasseri ATCC 33323]
    MLMEVTMINITTNQLAEILAKDSTINLYDLRTPIEFASGHIPDSHNLPFEELKYFNDPKNETYYFICRSGDLSHYACQTL
    KAKGYKNLININGGILNWKGKVQSLT

    >gi|116630170|ref|YP_815342.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactobacillus gasseri ATCC 33323]
    MKTIKNIIIGFGKGGKTLAKFLAQKSEEVLVIEKSNKMYGGTCINIACLPSKRLIIEAANGVSYVDAVSGKNEMTAQLRN
    KNYHMLADEQTVTVLDGEAHFIADHEIEVVLTNGKKEQFKGERIFINTGAVPVMLPIPGLKESKYILDSTQAMDEKKMPE
    NLTIIGAGYIGLEFASMFAKYGSKVTVLDHSREFLSREDDDISQLVKKDLEDAGVHFELGADIEEIIDEENEAKVRYQIN
    GQEKEISANRILAATGRKPNIENLGLENTSIEITDRGAIKVDDFLRTTVDNVWAIGDVKGGLQFTYISLDDFRIIKDQLF
    GTGARMISDRKVVPYSVFISPALSQVGLNEKQARNQNKEYKLFKLPVAAIPKAKVAKDSRGLFKALVDPETEEILGATLY
    GIESYELINLISLAMKAHLSYTVLRDQIYTHPTMSEAFNDLFK

    >gi|116629364|ref|YP_814536.1| redox protein, regulator of disulfide bond formation [Lactobacillus gasseri ATCC 33323]
    MTKYTVKSKLTDTPWQIENRTKKHKFMADESASGKNVAPNPVEYLAGAVNSCISISAGMIANVHHLDVKNFKVTTQAITT
    KLGHGKSVVSEMLITVSFDSSMSQEEKQDFLAHTLHVSTVYQTVSQSVKTYVELED