Lactobacillus fermentum IFO 3956 uid58865

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|184154516|ref|YP_001842856.1| arsenate reductase [Lactobacillus fermentum IFO 3956]
    MPTFYCYSRCSTCKKAQKWLDDHQVAYDQQDLVAEPPAKELFVKWLTEHQDLGLRYFFNTSGQHYREQKLKDKLPTMTID
    EAATLLSSDGKLIKRPLMVEGSQLTCGFKEDVYEQTWR

    >gi|184154624|ref|YP_001842964.1| hypothetical protein LAF_0148 [Lactobacillus fermentum IFO 3956]
    MTDYQEQLAECQANNKNLFASVGEAGKGFGALHAASVADGVLDTKTKELMSLAISVVERCEGCITQHTAACIKAGASRKE
    FAEAISVAIMMAGGPATVYGGKALACFDQLSK

    >gi|184154757|ref|YP_001843097.1| putative glutaredoxin [Lactobacillus fermentum IFO 3956]
    MVTVFSKNNCIQCKMTKRFLEEHNVAFIEHNIDEQPEFIENLKAEGFLATPVVKLPDGNAFTGFRPDRLSALA

    >gi|184154885|ref|YP_001843225.1| alkyl hydroperoxide reductase [Lactobacillus fermentum IFO 3956]
    MNFLNQEIDDFKVQAYQDGDTKEVTKADVLGKWSIFFFYPADFSFVCPTELEALQDKYEEFKQADAEIYSVSEDTEFVHK
    AWAEASEEIGKVKYPMLADPAGKLARMFDVLDEEAGQAYRGVFIVDPDGKIQSYTINNMGIGRSAEEILRTLQAAQFVRE
    HGDRVCPANWKPGDDTIKPSLDLVGKL

    >gi|184154886|ref|YP_001843226.1| thioredoxin reductase [Lactobacillus fermentum IFO 3956]
    MDQEHIYDLIIIGAGPAGLSAGIYAGRATLDTLILEADMVGGQVTTTSIVYNYPAAPAIDGTKLANQMQKQAADFGVTIK
    RDGVQEVQLDGEIKVITTKSGHQYQARSVVVATGAHPRKVGFKGEDEFRGRGVAY
    CSTCDGELFSGLQVFVVGGGYAAAE
    EADYLTRYAKHVTVLVRGDHFSCPPLTASRALDNPKVSVEYNTEIKEVSGDTYLTAMTLVNNQTGQEQTYQVEEGDKTFG
    VFVYVGTEPETNLFKGQLDLDSHGYILADEQCATNIAGVYAAGDVLAKELRQIITAASDGALAATNAEAYVTAEKKRLGI
    PVHVTPAKPAAKTVGQTSQVADQPAPQHTGDWFTPDLVEQLKAIFGRLTKDVTLQVLGDDSPLSQELTSFVDELAKLDSH
    LQVATAPVPADLDLAPQLRLLVDGLDTGLHFAGVPTGHEINSLILGIYNVAGPGQEIAPELVERIKALPATEIEIGVSLT
    CHFCPDVVAACQRMASLNPQVTATMIDLQHFPQLREERQIMSVPATMIDGGPVIFGSQTLEELVQAAEQATVKS

    >gi|184154972|ref|YP_001843312.1| thiol peroxidase [Lactobacillus fermentum IFO 3956]
    MEVTINGEHRQLVGNPPAVGEDVPHFKVFDKDNQKVKTRELFGKPTLISVVPNINTSVCSIQTKKFNQLMDQYPGANFLT
    VSTNTIEDQQNWCAAEGVKNMKMVADSEQSFGYALKVLIPDEGILARSIWVLDADGKIVYEQVVPEVVDEPDYDAALAAL
    KKLL

    >gi|184155004|ref|YP_001843344.1| thioredoxin [Lactobacillus fermentum IFO 3956]
    MSVHETSDATFEQDTATGVALIDFWATWCGPCRMQSPVVEALDQEMGEQVGFHKLDVDANPNVAEQFQIMSIPTLMITKD
    GQVVDQLIGYHSKEQVAQLLKQYL

    >gi|184155032|ref|YP_001843372.1| hypothetical protein LAF_0556 [Lactobacillus fermentum IFO 3956]
    MVTLYTSPSCTSCRKARGWLRDHQIPFTERNIFADPLTMAEIKNILRMTENGTEDIISKRSKAYQSLKIDVDDLPMTELY
    ELIRKTPGLLRRPIIIDDKRLQIGYNEDEIRRFLPREVRALELAEAQRRADLVE

    >gi|184155267|ref|YP_001843607.1| peptide methionine sulfoxide reductase [Lactobacillus fermentum IFO 3956]
    MTAELKTATFAGGCFWCMVQPFDTYPGIERVVSGYTGGHVANPTYEQVCAGGTGHTEAVQITYDPSKVSYADLVEIYWQQ
    TDPTDAFGQFQDRGDNYRPVIYYQTEEEKGIAEASKQKLQDSGRFDQPIVTTIEPAQPFYPAEEYHQDFYKKDPFRMMIE
    EAGGRQKFIDQHWKGVSGK

    >gi|184155270|ref|YP_001843610.1| peptide methionine sulfoxide reductase [Lactobacillus fermentum IFO 3956]
    MASETAIFAGGCFWCMVQPFDTYPGIKKVESGYTGGHVVNPTYEQVKAGGTGHTEAVRITFDPSVVSYADLVEIYWQQTD
    PTDAFGQFQDRGDNYRPVIFVKDEEQRAIAQASKDALANSGRFTDPIVTTIEDAKPFYVAENYHQDFYKKDPERMKLEKA
    GGRKQFIEDNWKK

    >gi|184155384|ref|YP_001843724.1| peptide methionine sulfoxide reductase [Lactobacillus fermentum IFO 3956]
    MEDKQAALKKLTLTQFAVTQEAATERPFTGKYDDFYEEGLYVDVVSGEPLFSSKDKYDAGCGWPSFTKPVTKLTMNRDQS
    FGMERTEVRSKEADSHLGHVFTDGPVDRGGLRY
    CINSAALRFIPVAELEEAGYGQYRSLFE

    >gi|184155539|ref|YP_001843879.1| molybdopterin biosynthesis protein MoeB [Lactobacillus fermentum IFO 3956]
    MTSIGAAGQEKISQATVLVAGCGALGSYVAEQLTRAGVAHLILVDPDQVSLTNLQRQALFDEDDVKQHRLKVMAAKNHLN
    QINHEVEITPLPAPLSIDLLNELDFDLVIDCLDNYQARDLINQAAWVHQFSYVFGSCAGNFGNVMLIDPSKGPCLNDVFP
    DLEALKATD
    CDLIGVTTPLVPLVAANQVSLALHYLVDPATVNYDRLLTIDAWNGDFNYFRVQKRPDCPVCANHKLTVEPD
    VSPQVRVLCGSQTYLMDLTERLDLNDLADWLTDRQIEVEQSPKFIHFTFNQNELSAFKNGRLILYGAPDLADAENQFDRF
    LAVTNHLMTQ

    >gi|184155613|ref|YP_001843953.1| dihydrolipoamide dehydrogenase [Lactobacillus fermentum IFO 3956]
    MVVGDYAIDLDTIVIGSGPGGYVAAIHAAELGQKVAVIEKENTLGGVCLNVGCIPSKALIQVSENYRTALENEDEGISAS
    DVKLDWAKVQEFRAGVVNKMTNGVSYLFKKNKIDVIHGVAFLKTDHSLRVIDGENAQTYTFKHLIIATGSHPIEIPGFKF
    GGRVIDSTGVLELKELPKELVIIGGGYIGSELAGAYARFGTHVTILEGTDSILNAYEKDLVKITEKKFKELGVTVITKAM
    AKEAKDTGDAVEVSYEQDGKVNTIKADYVAVAVGRKPNTKDMGLEQVGIETTDRGLIKVDAQGRTNKEDIFAIGDIVAGA
    ALAHKASYEGKIAAEAIAGQSSVVDYRAMPAVCYVDPEIATTGLTAAQAKEQGLDVKASRFPFSANGRATSKKATDGFVR
    LVSLKDSGVIVGAQIIGDSASDMISELTLAIESGSTVEDIALTIHPHPSLSEAVMDAADVALGFPTNI

    >gi|184155798|ref|YP_001844138.1| thioredoxin [Lactobacillus fermentum IFO 3956]
    METLPKTDLAGLNDRVKDGKHVLFFTAGWCPDCAFIKPAMPEIERDFADYQFIKVDRDENIDLAADLGIMGIPSFVAYKD
    GQEIGRFVNKDRKTKEQVESFLRSL

    >gi|184155922|ref|YP_001844262.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus fermentum IFO 3956]
    MQTTCHYQSPLGDILLVSDEQGVCGLWFEDGRYYADTVEDDAQAGTSPALDQARRWLDEYFAGQAPTWLPPLHVQGTPFQ
    RQVWERLLTIPYGHLLTYGELAKRVAKLRHRTSMSAQAVGNAVGKNHLSLFIP
    CHRVIGAHGNLTGYGGGLERKIALLEL
    EGHLASDFSWPS

    >gi|184155936|ref|YP_001844276.1| NADH peroxidase [Lactobacillus fermentum IFO 3956]
    MDKAKVIIVGASHGGHESAIELLDKYDNVDVTIYEMGDFVSFMSCGMQLYLEDQVTDVNDVRNFRPEDITSKGGNIFNNH
    QVTAIDVDQKQVTVKDLKEGTEEQVAYDKLILSSGVTPKNLPVPGTDLENVYLMRGYDWATKIKAALTDDSIKNVAVVGS
    GYIGIEAAEVFAKKGKHVTLFDFIDRPLGNYLNHEMTEIIDKTLTDNGVQVEMSQSITAFKGDGKVASVETKKGSYPADL
    VIQAAGVQPNTEWLKGVVDLTDRGFINVDGYLRTNVPDIFAVGDAILPLSIPAGKPSPIALATTARREAQYVVNHIFEKK
    PTQIFKGVVGSSALHVFDEHFASTGVNEFTAERSNVEIVNSHYVDHIRPAYVPESEGNVRVDVDITFDPHTHIVLGGAVL
    STCDLTAQGNVLALAVEHRLTLEDLAEADFFFQPGYDRQWSLINLAAQHALGYARF

    >gi|184155942|ref|YP_001844282.1| hypothetical protein LAF_1466 [Lactobacillus fermentum IFO 3956]
    MQKAILQLETLACPTCMQKIAGAIANVDGVEKTSVKVLFNASKAKVNFDPEKTNLDTITQAVKNIGYDVLKASAK

    >gi|184156091|ref|YP_001844431.1| glutathione reductase [Lactobacillus fermentum IFO 3956]
    MELYDYILLGTGPAGYKLAKGLAGDNHRILAVEPNLFGGTCPNVGCEPKIFLEGAVRAALATTNLVGKGIDQAATVDWAT
    LMKTKKARFDSWPSETKAIYEQLPGVTVKVGAGRFTGPHTIAVGDEEFAGDQIVIATGARPHRLDFPGSELTHDSTDVLS
    LDQLPATTTIIGGGYVAMELATLLAAAGSQVTLLIRGDRVLKNFARENVRRLVKEMTGRGIRFVFNTSPAELKPQDGRLT
    LITNNGNALTTDYVIDATGRIPNVEALNLAAAGIEYDRHGIAVDENLQTSFAGVYAVGDVVNRPWPKLTPVAERQADYLL
    TRFGHDDPTAPFNLPVVASAVFSYPTLAQAGVNPDEATAGQHVEEFDWGGSSLYAGQNEHPHYICVYDNQDRLVGISALG
    AGAADDVNAVLPAIGLGLSRAQWQAAMIEAYPTTGDKVAALLK

    >gi|184156092|ref|YP_001844432.1| thioredoxin [Lactobacillus fermentum IFO 3956]
    MAVAETTDATFEQDTNSGVVLTDFWATWCGPCRMQSPIVETVADDMAGQVTVNKLDVDANPQTAAAFGVMSIPTLLIKKD
    GQVVDKLIGLHTKDQIEDTLKKYL

    >gi|184156166|ref|YP_001844506.1| thioredoxin [Lactobacillus fermentum IFO 3956]
    MAQVAHKDNFKQLVEGPVTVVDFWAPWCGPCKMMAPVMDQLEAEYGDRIKFVKFNIDEDQETATQFKVMSIPSLVLFRDG
    KAKEKVTGLYPKDRLAHYLERKLSEG

    >gi|184156177|ref|YP_001844517.1| hypothetical protein LAF_1701 [Lactobacillus fermentum IFO 3956]
    MEKVLMELGGMSCPSCLDKIKTAVEHQAGVSEVKVLFNAGKLKATVDSDQTTATDLKQVVENLGYQVNKVKEKELV

    >gi|184156187|ref|YP_001844527.1| hypothetical protein LAF_1711 [Lactobacillus fermentum IFO 3956]
    MAKSGHRTPRTALTCALSLAHGLPIGWCVLPITHFPFLLVSSAYNGCKRIHKEGKVMTFRSLYHTEVINDAGLNGHARVT
    LGGDFDVLTSSPLQDDPGTNPEQLLGLALATCLNATIEAEEGRRGLEHAAEVKVGVDMGKDTEGYQFFLDCQVRIPQVAE
    AEAQEILAKCERR
    CPVAKIVGSSQNVRVHLVKQFAF