Lactobacillus delbrueckii bulgaricus ND02 uid60621

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|313123191|ref|YP_004033450.1| mertp family mercury (hg2+) permease, binding protein merp [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MKKAILQLETLACPTCMQKIAGAIANVDGVEKTSVKVLFNASKAKVNFDPEKTNLDTITQAVKNIGYDVLKASAK

    >gi|313123283|ref|YP_004033542.1| arsenate reductase related protein, glutaredoxin family [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MVDLYVSPSCTSCRKAKQWLEQHNIPYKERNIISDPLNREEIIHVLRMTEEGTEEIVSTRSKAFQELNIDLDDISMNELI
    DLIEKNPSLLRRPIILDDRRMQVGYNEDEIRRFLPRSVRRLEIARAKRLADQDF

    >gi|313123322|ref|YP_004033581.1| thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MTKEVDVVIIGAGPAGMTAAVYAARANLKTVLLDRGIYGGQMNNTADIDNYPGFVEVQGPELGEKMYQTVQNAGASYEYG
    DVQAVKLEGDYKRVITDSEEYLAPAVIIATGSEHKHLNVPGEETYSGHGVSY
    CAVCDAAFFRDEDVTVIGGGDSAIQEGL
    YLAQSAKSVTVVHRRDQLRAKPELQEKAFKHPKIKFVWNALTEEIVGEDGKVSGIRYKDKVSGEEKEFATKGVFIYVGVL
    PVTKALDGLDILDENGWIPTDELMRTRQEGIFAAGDVRPKDLRQVTTAVGEGSVAGQEAYNYLQAKGFLK

    >gi|313123370|ref|YP_004033629.1| peptide methionine sulfoxide reductase msra [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MEKKLDSAIFAGGCFWCMVAPFDTLPGIESVTAGYTGGHVPNPTYEQVCSHTTGHTEAVKIVFDPDLMSYEDLLGYYWQV
    TDPTDASGQFQDRGDNYRPVIFYNSPEQKAAAEKSKQELAESGRFDDPIVTKIEPAAPFYAAEDYHQQFYLKHPDRYAAE
    EAGGRAQFIKEHWGK

    >gi|313123459|ref|YP_004033718.1| acetoin/pyruvate dehydrogenase complex, e3 component, dihydrolipoamide dehydrogenase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MTEKETKKTVKNIIIGFGKGGKTLAKFLGQQGEEVLLVEKSAKMYGGTCINIACLPSKRLILEGAAGSDFSEAVAGKNEM
    TAQLREKNYQMLAQEETVTVLDGQARFIGEKEIEVTGPAGKQIFKSDRIFINTGASPVLPPVPGLKESKKRLDSTQAMDL
    TSLPKELLILGAGYIGLEFAGMFANYGSQVTVLDHSPEFLPREDDDIKAAVKADLERAGVKFILGADVEKVSDEADQVVI
    DYKLGEEKLTAAADKVLVAAGRRANTADLNLPAAGIETDDRGNIKVDDRLRTSADQVWALGDVKGGPQFTYVSLDDFRIV
    KDQLFGEDKRRVSDRQILPTSVFITPPLSAVGLNEKAAQKAGLDYQLFKLPVAAIPKAKVAKDSRGLFKALVDPASGQIL
    GASLYGLESHELINQIALAMKAKLPYSFLRDQIYTHPTMSEAFNDLFKQ

    >gi|313123747|ref|YP_004034006.1| rhodanese-related sulfurtransferase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MNLFQVNDINAGVEEYQKTPQAKLIDVREEDEYAAGHIPASINIPLSKIEAAQGEITDLDTPLFVYCRSGNRSGQAVAWL
    KQAGYSKVQNIGGIANYSGKTE

    >gi|313123794|ref|YP_004034053.1| glutathione reductase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MKKYDYIIIGSGPAANHLLFKLARTDRTALVIENNLWGGTCPNTGCQPKIFLEGAVRPVLNTYYLTGKGVKAAAQLDWKT
    LIKRKKEIWAEFRAEERSSIESDQVDTVFGSGVITGPHTVQVADQEYEGKNIVIATGLLPHHLEVPGSEYAITNDEFFDL
    DELPKKAVVIGGGYVALELATILQAAGSEVTVLQHSEKLLRPFDQEYVEKLTEIMEERGIVIHLNTPVKAIAKNSAAYEV
    TAENGQKFETDLVIDASGRRANVDGLGLEKLGIKFDPVKGVAVNEHLQTNVPSIFAAGDVADNGQMNLTPVAWVDSYHIY
    DFVENGLKEGVKYPAVATSTFTYPQIAQVGKRESEMAAGDTVRRMKLGSTFASMGEGDEEAELKVIFNQVGEVVGASEIS
    INAGEDINLFAPLIGRKDPAEFAMNNLGFAFPTLANKLDVLFR

    >gi|313123863|ref|YP_004034122.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MDDNEMWQTVQTCDPSYDGEFFYAVQTTRIFCRPSCKSKCPRRNNVEYFKSSAEAEAAGYRPCKRCRPDLPQYDPDRDLA
    EASKVVFDNYFSDRQELNQQLKELGVTRKQMSLVFKRYYDMKPAEYLIQVRIAAAKQALQAGASVFDAAADSGYTNYSSF
    YAHFRKLSGMPPAKYRQLFAQNISRAVMDTPIGPLRIVASQDAILCVEPANYLEKKTGQATEQVPADRIIPNDPSGDLVK
    ACMRELKEYFAGQRQRFDLPLSPEGTSFQQKVWQQLQQIPYGETRSYQQLAEMTGDKNASRAIGLANNCNPILILIP
    CHR
    VIGADGSLTGYAAGLAAKKLLLDLEKGGTKK

    >gi|313124112|ref|YP_004034371.1| arsenate reductase related protein, glutaredoxin family [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MPKFYGYKRCSTSRKAQKWFDDKGISYDFQDLVETPPEKDLLLSWLTKYQDRGLRYFFNTSGQHYRQMGLKDKLPNMTIE
    EAADLLSKDGKLIKRPLVVDDQHLTCGFKEEVYEQTWK

    >gi|313124204|ref|YP_004034463.1| thiol-disulfide isomerase and thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MEEYKVVDQAKLADLVKSGRTVVEFSADWCSDCRFLEPAMPAIEADFADSKFIKIDRDGSIDLCKEMNIMGIPSFVVYQD
    GQEIGRLVNGDRKTKQEVEAFLRSLD

    >gi|313124255|ref|YP_004034514.1| thiol-disulfide isomerase and thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MVDEITDATFEEETKDGLVLVDFWATWCGPCRMQSPVIEALAEERQDVHFTKMDVDDNPETAKNFGIMAIPTLLIKKDGQ
    VVDRLTGYTPKEKLNEILDQYAD

    >gi|313124553|ref|YP_004034812.1| methionine sulfoxide reductase b [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MNEKADLKDRLTPMQYAVTQNAATEPPYTGEYDNFFEKGIYVDVVSGEALFSSLDKYDSGCGWPAFTKPLVKLTQRRDQS
    FGMERTEVRSRQADSHLGHVFTDGPLDKGGLRY
    CINSAALKFIPYDQLEEAGYGEYRQLFE

    >gi|313124762|ref|YP_004035021.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (e3) component, related enzyme [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MKNPYDFDVLYLGSGHGAFDGAGPLATSGKKVAVVEGDMIGGTCPNYGCNAKITLDTPVVLQRLAERMQGVVSGNIKINW
    SALVAHKQAVIKPLPNAIGTGLTQNGVTIIHGYGKFQDAHTVVVGEKTYTADKIVIATGQRPHRIDVPGTDLAHDSRAFM
    DLDVLPKRIGILGSGYISMEFATIANAAGADVHVLMHHDRALREFHQPFVEDVMADMTKRGIQFTPNAAVTALEKTTDGI
    VIHYGDKEQLVVDWVLDATGRIPNVEQLGLENIGVKFNQHGILVDDYLRTNVANIYASGDVLDKLQPKLTPTATFESYYL
    YKLLSGQTTAPIDYPAIPSTVYTSPRIAKVGVAPEAVKDDTNKVVHNHIPDDWYHQTDQETVGDSLLVFDQEHHLVGATE
    YSAQAEDAINTLLPAIVYHLSRDQMWQMAHIFPAEGAAAWHKIR

    >gi|313122978|ref|YP_004033237.1| glutaredoxin-related protein [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MLKVYGTKICPDCIACEASFKKYGIGYEFVNIFATMPDFKEFLRLRDASPAFAHAKEQGSVGIPACVKEDGEIFTDWEGF
    LKDQGLEPIWPEAADQAKAEIAAQCDLRQHNC

    >gi|313123994|ref|YP_004034253.1| enolase 3 [Lactobacillus delbrueckii subsp. bulgaricus ND02]
    MTKVVIENVHAREIFDSRGNPTVEVEVTLSNGVVGRAEVPSGASTGENEAVELRDGGSRLGGKGVMKAVNNVNTAINNEL
    QGADPFNQPAIDKAMIELDGTPNKGKLGANAILGTSMATAVAAAKATHQPLYRYLGGTDLSMPQTFHNVINGGEHADNGI
    DIQEFMITPVKKTSFRDGFEKIVNTYHTLKKVLEEKGYETGLGDEGGFAPNMKDSEEALKALHEAIERAGYVPGEDIAIA
    CDCAASYYYNKEDGKYHLEGKVLDGDQLAEYYDKLLAEFPELISMEDPYDENDTEGMVKFTQSHKDRLQIVLDDFI
    CTNP
    RLLEKAIKEGAGNASLIKLNQIGTVTETLETIRISRKHGYNTMISHRSGETGDTFIADFAVATNGGQLKTGAPARSERVE
    KYNQLLRIEEQLGDGERLDFFPAQD