Lactobacillus delbrueckii bulgaricus ATCC BAA 365 uid57987

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116513685|ref|YP_812591.1| arsenate reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MVDLYVSPSCTSCRKAKQWLEQHNIPYKERNIISDPLNREEIIHVLRMTEEGTEEIVSTRSKAFQELNIDLDDISMNELI
    DLIEKNPSLLRRPIILDDRRMQVGYNEDEIRRFLPRSVRRLEIARAKRLADQDF

    >gi|116513718|ref|YP_812624.1| thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MTKEVDVVIIGAGPAGMTAAVYAARANLKTVLLDRGIYGGQMNNTADIDNYPGFVEVQGPELGEKMYQTVQNAGASYEYG
    DVQAVKLEGDYKRVITDSEEYLAPAVIIATGSEHKHLNVPGEEIYSGHGVSY
    CAVCDAAFFRDEDVTVIGGGDSAIQEGL
    YLAQSAKSVTVVHRRDQLRAKPELQEKAFKHPKIKFVWNALTEEIVGEDGKVSGIRYKDKVSGEEKEFATKGVFIYVGVL
    PVTKALDGLDILDENGWIPTDELMRTRQEGIFAAGDVRPKDLRQVTTAVGEGSVAGQEAYNYLQAKGFLK

    >gi|116513767|ref|YP_812673.1| peptide methionine sulfoxide reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MKKKLDSAIFAGGCFWCMVAPFDTLPGIESVTAGYTGGHVPNPTYEQVCSHTTGHTEAVKIVFDPDLMSYEDLLGYYWQV
    TDPTDASGQFQDRGDNYRPVIFYNSPEQKAAAEKSKQELAESGRFDDPIVTKIEPAAPFYEAEDYHQQFYLKHPDRYAAE
    EAGGRAQFIKEHWGK

    >gi|116513850|ref|YP_812756.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MTEKETKKTVKNIIIGFGKGGKTLAKFLGQQGEEVLLVEKSAKMYGGTCINIACLPSKRLILEGAAGSDFSEAVAGKNEM
    TAQLREKNYQMLAQEETVTVLDGQARFIGEKEIEVTGPAGKQIFKGDRIFINTGASPVLPPVPGLKESKKRLDSTQAMNL
    TSLPKELLILGAGYIGLEFAGMFANYGSQVTVLDHSPEFLPREDDDIKAAVKADLERAGVKFILGADAEKVSDEADQVVI
    DYKLGEEKLTAAADKVLVAAGRRANTADLNLPAAGIETDDRGNIKVDDRLRTSADQVWALGDVKGGPQFTYVSLDDFRIV
    KDQLFGEGKRRVSDRQILPTSVFITPPLSAVGLNEKAAQKAGLDYQLFKLPVAAIPRAKVAKDSRGLFKALVDPASGQIL
    GASLYGLESHELINQIALAMKAKLPYSFLRDQIYTHPTMSEAFNELFKQ

    >gi|116514065|ref|YP_812971.1| peptide methionine sulfoxide reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MTENNKQAKATDTKPKGALDTAIFAGGCFWCMVSPFDKLPGIEKVVSGYTGGHVANPTYEEVCTGKTGHTEAVEITFDPE
    KMPYQKLLQYYWQVTDPTDAMGQFQDRGDQYRPVIYYNSPAQKEAAEKSKQELAESGKFDDPIVTQIEPAQPFYPAEEYH
    QDFYKKDPLRYAMEEAGGREKFIKEHWDK

    >gi|116514124|ref|YP_813030.1| peptide methionine sulfoxide reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MTENNKQAKATDTKPKGALDTAIFAGGCFWCMVSPFDKLPGIEKVVSGYTGGHVANPTYEEVCTGKTGHTEAVEITFDPE
    KMPYQKLLQYYWQVTDPTDAMGQFQDRGDQYRPVIYYNSPAQKEAAEKSKQELAESGKFDDPIVTQIEPAQPFYPAEEYH
    QDFYKKDPLRYAMEEAGGREKFIKEHWDK

    >gi|116514150|ref|YP_813056.1| rhodanese-related sulfurtransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MGLFQANDINAGVEEYQKTLQAKLIDVREEDEYAAGHIPASINIPLSSIEAAREEITDLDTPLFVYCRSGNRSGHAVTWL
    KQAGYSKVQNIGGIANYSGKTE

    >gi|116514381|ref|YP_813287.1| arsenate reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MPKFYGYKRCSTSRKAQKWFDDKGISYDFQDLVETPPEKDLLLSWLTKYQDRGLRYFFNTSGQHYRQMGLKDKLPNMTTE
    EAADLLSKDGKLIKRPLVVDDQHLTCGFKEEVYEQTWK

    >gi|116514457|ref|YP_813363.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MEEYKVVDRAKLADLVKSGRTVVEFSADWCSDCRFLEPAMPAIEADFADSKFIKIDRDGSIDLCKEMNIMGIPSFVVYQD
    GQEIGRLVNGDRKTKQEVEAFLRSLD

    >gi|116514506|ref|YP_813412.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MVDAITDATFEEETKDGLVLVDFWATWCGPCRMQSPVIEALAEERQDVHFTKMDVDDNPETAKNFGIMSIPTLLIKKDGQ
    VVDRLTGYTPKEKLNEILDQYAD

    >gi|116514772|ref|YP_813678.1| methionine sulfoxide reductase B [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MNEKADLKDRLTPMQYDVTQNAATEPPYTGEYDDFFEKGIYVDVVSGEALFSSLDKYDSGCGWPAFTKPLVKLTQRRDQS
    FGMERTEVRSRQADSHLGHVFTDGPLDRGGLRY
    CINSAALKFIPYDQLEEAGYGEYRQLFE

    >gi|116513399|ref|YP_812305.1| glutaredoxin-like protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MLKVYGTKICPDCIACEASFKKYGIGYEFVNIFATMPDFKEFLRLRDASPAFAHAKEQGSAGIPACVKEDGEIFTDWEGF
    LKDQA

    >gi|116514271|ref|YP_813177.1| phosphopyruvate hydratase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
    MTKVVIENVHAREIFDSRGNPTVEVEVTLSNGVVGRAEVPSGASTGENEAVELRDGGSRLGGKGVMKAVNNVNTAINNEL
    QGADPFNQPAIDKAMIELDGTPNKGKLGANAILGTSMATAVAAAKATHQPLYRYLGGTDLSMPQTFHNVINGGEHADNGI
    DIQEFMITPVKKTSFRDGFEKIVNTYHTLKKVLEEKGYETGLGDEGGFAPNMKDSEEALKALHEAIERAGYVPGEDIAIA
    CDCAASYYYNKEDGKYHLEGKVLDGDQLAEYYDKLLAEFPELISMEDPYDENDTEGMVKFTQSHKDRLQIVLDDFI
    CTNP
    RLLEKAIKEGAGNASLIKLNQIGTVTETLETIRISRKHGYNTMISHRSGETGDTFIADFAVATNGGQLKTGAPARSERVE
    KYNQLLRIEEQLGDGERLDFFPAQD