Lactobacillus delbrueckii bulgaricus ATCC 11842 uid58647

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|104773690|ref|YP_618670.1| hypothetical protein Ldb0578 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MVDLYVSPSCTSCRKAKQWLEQHNIPYKERNIISDPLNREEIIHVLRMTEEGTEEIVSTRSKAFQELNIDLDDISMNELI
    DLIEKNPSLLRRPIILDDRRMQVGYNEDEIRRFLPHSVRRLEIARAKRLADQYF

    >gi|104773721|ref|YP_618701.1| thioredoxin reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MTKEVDVVIIGAGPAGMTAAVYAARANLKTVLLDRGIYGGQMNNTADIDNYPGFVEVQGPELGEKMYQTVQNAGASYEYG
    DVQAVKLEGDYKRVITDSEEYLAPAVIIATGSEHKHLNVPGEEIYSGHGVSY
    CAVCDAAFFRDEDVTVIGGGDSAIQEGL
    YLAQSAKSVTVVHRRDQLRAKPELQEKAFKHPKIKFVWNALTEEIIGEDGKVSGIRYKDKVSGEEKEFATKGVFIYVGVL
    PVTKALDGLDILDENGWIPTDELMRTRQEGIFAAGDVRPKDLRQVTTAVGEGSVAGQEAYNYLQAKGFLK

    >gi|104773763|ref|YP_618743.1| peptide methionine sulfoxide reductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MKEKLDSAIFAGGCFWCMVAPFDTLPGIESVTAGYTGGHVPNPTYEQVCSHTTGHTEAVKIVFDPDLMSYEDLLGYYWQV
    TDPTDASGQFQDRGDNYRPVIFYNSPEQKEAAEKSKQELAESGRFDDPIVTKIEPAAPFYEAEDYHQQFYLKHPDRYAAE
    EAGGRAQFIKEHWGK

    >gi|104773843|ref|YP_618823.1| putative pyridine nucleotide-disulphide oxidoreductase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MTEKETKKTVKNIIIGFGKGGKTLAKFLGQQGEEVLLVEKSAKMYGGTCINIACLPSKRLILEGAAGSDFSEAVAGKNEM
    TAQLREKNYQMLAQEETVTVLDGQARFIGEKEIEVTGPAGKQIFKGDRIFINTGASPVLPPVPGLKESKKRLDSTQAMNL
    TSLPKELLILGAGYIGLEFAGMFANYGSQVTVLDHSPEFLPREDDDIKAAVKADLERAGVKFILGADAEKVSDEADQVVI
    DYKLGEEKLTAAADKVLVAAGRRANTADLNLPAAGIETDDRGNIRVDDRLRTSADQVWALGDVKGGPQFTYVSLDDFRIV
    KDQLFGEGKRRVSDRQILPTSVFITPPLSAVGLNEKAAQKAGLDYQLFKLPVAAIPKAKVAKDSRGLFKALVDPASGQIL
    GASLYGLESHELINQIALAMKAKLPYSFLRDQIYTHPTMSEAFNDLFKQ

    >gi|104774082|ref|YP_619062.1| hypothetical protein Ldb1151 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MGLFQANDVNAGVEEYQKTLQAKLIDVREEDEYAAGHIPASINIPLSSIEAAREEITDLDTPLFVYCRSGNRSGHAVTWL
    KQAGYSKVQNIGGIANYSGKTE

    >gi|104774296|ref|YP_619276.1| hypothetical protein Ldb1432 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MPKFYGYKRCSTSRKAQKWFDDKGISYDFQDLVETPPEKDLLLSWLTKYQDRGLRYFFNTSGQHYRQMGLKDKLPNMTTE
    EAADLLSKDGKLIKRPLVVDDQHLTCGFKEEVYEQTWK

    >gi|104774362|ref|YP_619342.1| thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MEEYKVVDRAKLADLVKSGRTVVEFSADWCSDCRFLEPAMPAIEADFADSKFIKIDRDGSIDLCKEMNIMGIPSFVVYQD
    GQEIGRLVNGDRKTKQEVEAFLRSLD

    >gi|104774408|ref|YP_619388.1| thioredoxin [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MVDEITDATFEEETKDGLVLVDFWATWCGPCRMQSPVIEALAEERQDVHFTKMDVDDNPETAKNFGIMSIPTLLIKKDGQ
    VVDRLTGYTPKEKLNEILDQYAD

    >gi|104774639|ref|YP_619619.1| methionine sulfoxide reductase B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MNEKADLKDRLTPMQYDVTQNAATEPPYTGEYDDFFEKGIYVDVVSGEALFSSLDKYDSGCGWPAFTKPLVKLTQRRDQS
    FGMERTEVRSRQADSHLGHVFTDGPLDRGGLRY
    CINSAALKFIPYDQLEEAGYGEYRQLFE

    >gi|104773413|ref|YP_618393.1| hypothetical protein Ldb0217 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MLKVYGTKICPDCIACEASFKKYGIGYEFVNIFATMPDFKEFLRLRDASPAFAHAKEQGSAGIPACVKEDGEIFTDWEGF
    LKDQGLEPIWPEAADQAKAEIAAQCDLRQHNC

    >gi|104774181|ref|YP_619161.1| phosphopyruvate hydratase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
    MTKVVIENVHAREIFDSRGNPTVEVEVTLSNGVVGRAEVPSGASTGENEAVELRDGGSRLGGKGVMKAVNNVNTAINNEL
    QGADPFNQPAIDKAMIELDGTPNKGKLGANAILGTSMATAVAAAKATHQPLYRYLGGTDLSMPQTFHNVINGGEHADNGI
    DIQEFMITPVKKTSFRDGFEKIVNTYHTLKKVLEEKGYETGLGDEGGFAPNMKDSEEALKALHEAIERAGYVPGEDIAIA
    CDCAASYYYNKEDGKYHLEGKVLDGDQLAEYYDKLLAEFPELISMEDPYDENDTEGMVKFTQSHKDRLQIVLDDFI
    CTNP
    RLLEKAIKEGAGNASLIKLNQIGTVTETLETIRISRKHGYNTMISHRSGETGDTFIADFAVATNGGQLKTGAPARSERVE
    KYNQLLRIEEQLGDGERLDFFPAQD