Anaeromyxobacter dehalogenans 2CP 1 uid58989

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|220915238|ref|YP_002490542.1| methylated-DNA/protein-cysteine methyltransferase [Anaeromyxobacter dehalogenans 2CP-1]
    MTARLRYRSPVGILTVEASDEGVFGLSFGDRGPSRPGPSARARAHLDAAARALDDYFAGRPPSLPPLVLQGSPFQKRVWD
    ALLAIPWGDTRTYGEVAEALGAAGGARAVGGANHENPVAILVP
    CHRVVQARGRLGGYGGGVEVKRWLLAHEAAHGPALRP
    A

    >gi|220915418|ref|YP_002490722.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MALEVGRKAPDFALPDEDGNVVKLSSFKGKRVVVFFYPKANTSGCTQEASDFRDEVDAFTKQKVAVVGISKDAPAAQKKW
    KEKLGLPFPLLSDADTAVQQAWGVWKEKNMYGKKVMGTERTTVVIGPDGKVEKVFPKVKVDGHVASVLESL

    >gi|220915456|ref|YP_002490760.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MLTVGDRFPEFSLQAVTSLESGNEFETLTQASHPGKWKVVFLWPMDFTFICPTEIAEFGRRNGEFQDRDTQVLGASIDTH
    YVHLAWRKSHPDLKHLPFPMLADTRRELSSALGVLHRDGVALRATFIVDPEGVIRHVSVNDLSVGRNVDEVLRTLDALQT
    DELCPCNWKKGESTLQVA

    >gi|220915469|ref|YP_002490773.1| methionine-R-sulfoxide reductase [Anaeromyxobacter dehalogenans 2CP-1]
    MDKLILSDAEWRARLTPEQYQVLRGHGTEPPGTGCFLGTHEPGTYVCAGCGNPLFRSGEKFESGTGWPSFTRPVSPDAVV
    EVHDRSYGMRRTEVRCARCDGHLGHVFPDGPPPTGLRY
    CMNSAAMRHVAEGAPLDPPGAG

    >gi|220915486|ref|YP_002490790.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MDGAGDRGRAARPARGGARGGLALLAGAALAIGALVVADRRAAAGRAPGLDELAPPLVVTSVGGGGAIDLGKLRGRAVAV
    NFWAPW
    CGPCRAELPDLAEVKRELADACVELIGVAGDGGREEVAQVAAGQPYPMGFDADGAAMRAWRVDAVPTTYLVDPG
    GKIHAVISGAVGRAELLEALRPIIPATCPRS

    >gi|220915584|ref|YP_002490888.1| Rhodanese domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MKVPWWFPFGSVAEVSAVELNDRLRGRPAPQLVDVRTAAEFAQGRIRGAVNVPIGELRSRLDALKLDPARPVVAICLSGH
    RSVPAVRLLERGGFEAAQLAGGMLAWRGARLPEVKG

    >gi|220915653|ref|YP_002490957.1| Vitamin K epoxide reductase [Anaeromyxobacter dehalogenans 2CP-1]
    MPASHVPDTSRGKQPDRGGLPARSRALALAILVLALAGAGLAAELTLLHGRAHAGGASSFCAISERVNCDKVALSAWSSL
    LGVPLAAWGLLAYLVVAALALSALRRPRGDAGWPAGLLFAASAFMAAGAVFLAAISELVIGSLCIVCAGSWLVSFALAGC
    SFALARRAGGPAAALRSDVATLRARPLASATAALALLAASGGLLARYAGPPPAPAGAPAAAPAASLGPPGSIVLYEYSDY
    E
    CPFCARSHEANKPILASRPDVKVVRRHFPLDDTCNPKLIRPFHVGACDLARAAICAEAQGRFEQMDDALFRNQAEKAPV
    RELARRIGLDLPRFEACLSSPETEKRLADDIESAIQAGVRGTPSYVYGGKVYPGDLATLLGAKPAAASGG

    >gi|220915736|ref|YP_002491040.1| cytochrome c biogenesis protein transmembrane region [Anaeromyxobacter dehalogenans 2CP-1]
    MRFAIRTLLAALTFAAVAWIPDLIGLGPAGGSSDLRLGALLAEGSVLAFAVAFAGGVATSLTPCVYPLIPITVSIFGARK
    AGSRGEAMAVSALYVLGIAAMYSALGVGAALTGKAFGSVMQNPWVIGFVALVLAAMAASMFGAFELQLPASMQARLNGVG
    GAGRAGAFAMGLVSGIIAAPCTGPVLAAALTFVAAKGSVAFGFGIMFAYALGMGLLFFLIGAFSISLPKSGAWMETVKSV
    FGVALLAAALIFLKDAFPALKPLFSAARGAAFAAAAAAALGVLAGALSGSFHAPARQRLAKGLGVALLVGGIAYAAGAAG
    ARERARAHAGFSWLHSEAEALALAKAEGRPVIIDFWADW
    CTACKELDKIAWAKPEVQDEAARFVALKLDGTDGSDAFNAL
    AEKYGVVGMPTVIFIDPRGREVPDRVMGAISAGEMVQKLRAVDRACEGQPSPAKPAAVQGEPVAMACASRW

    >gi|220915739|ref|YP_002491043.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter dehalogenans 2CP-1]
    MAAAIEISEKAAVQIKALGAQKGTPAGGLRLGVKGGGCSGLSYFIDWSNEPARFDQVIERDGARVFVDPKSAVFLAGTVI
    DWQQTLMQTGFVFRNPNVKSACGCGESFTI

    >gi|220915993|ref|YP_002491297.1| Redoxin domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MAQVTLKGNPIHTNGELPAVGAKAPDFTLTTGELKDVTLAEWKGKRKILNIVPSLDTAVCATSTRKFNENAGKLPNTVVL
    VVSADLPFAQKRFCTTEGLQNVVPLSLVRGKHMAKDYGVLLQDGPLAGLTARAVVVLDESDKVVYRQLVPEIGQEPDYDA
    ALAAAKQ

    >gi|220916114|ref|YP_002491418.1| protein of unknown function DUF255 [Anaeromyxobacter dehalogenans 2CP-1]
    MLEPLPGAAPFPDDLARRLADAVRAGAAAGHGGAAPRFTNRLALERSPYLLQHAHNPVSWWAWGDEAFEEARRTGRPVFL
    SVGYST
    CHWCHVMERESFEDEEIARVLNERYVAIKVDREERPDVDAIYMTAVQLLTGSGGWPMSVWLTPDREPFFGGTYF
    PPRDGVRGPARGFLSILHEIAGLWERDPDRIRSATGALVEAVRTALAPAGPAAAQVPGPEPIEHAVALLERSFDERHGGL
    RRAPKFPSNVPVRLLLRHHRRTGEARSLRMATVTLERMAAGGLHDQVGGGFHRYSTDAEWLVPHFEKMLYDNALLALAYA
    EAWQVTGRRDFARVTRQTLDYLLRELTSPEGGLYSATDADSEGEEGRFFTWTEAELREALGDRAEAFLRFHGVRPEGNFE
    GRSVLHVPAPDEDAWEALAPDRAALYALRERRPRPLRDEKILAGWNGLAISALAFGGRALAEPRWVDAAARAADFVLTRL
    VKDGRLQRSWLAGRAGVPAYLEDHAFLVQGLLDLHEATFDPRWLAAAAELAGAQDRLFGDPEGGGWFQSATDHERLLARE
    KPTHDGAEPSGASVAALNALRLEAFTSDPRWRRAADGALRHHARTLAEQPLAMSELLLALDYASDAVREVVLIWPEGGDP
    GPFVDVLRRTFLPSRALTGAPEGEGLARLGEVAAIAAGKAAAGGRATAYVCERGACRLPAIAPEKLAAQVAPVRPYHP

    >gi|220916141|ref|YP_002491445.1| methylated-DNA/protein-cysteine methyltransferase [Anaeromyxobacter dehalogenans 2CP-1]
    MTLEHVVVESPIGPVHLVSDGRALCALDLGDTPLLRPALARRFGPDLALRAGRDPLGLASRARAWFAGDLGALDGLPLDP
    GGTPFQRQVWAELRRIPAGETRSYGALAAALGRPGAARAVGLANGRNPIAIAIP
    CHRVIGADGSLTGYAGGLDRKRWLLA
    HERAALDGAALRAPTGLAQDPGAVGGENRAAMARATVRQSARTT

    >gi|220916198|ref|YP_002491502.1| Thioredoxin domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MRTKAWLKGILLVAVLGAPVWATAADAAPAAGRAGGKAIPRLVDLGAGACVPCKAMAPILEGLRAEYAGRMDVVFIDVWK
    DRAAAEAHRVRMIPTQIFYGADGKELARHEGFIDRAGILARWKALGVRL

    >gi|220916201|ref|YP_002491505.1| redox-active disulfide protein 2 [Anaeromyxobacter dehalogenans 2CP-1]
    MKIQVLGTGCAKCKQLTANAEQAVAALGLEAKVEKVEDLREIMKLGVMTTPALVVDGVVKSAGKVLSPDAVRALLGS

    >gi|220916381|ref|YP_002491685.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MARILDRAPDFKLPAVRGRGAPVEVSLSALAGRWAVLLFYPRDFTAVCPTEVLELSKRMPELRALGAEAIGISVDDLDTH
    RRWIEEKLGEVAFPLAADPDRVVSRAYGALLEREGVAARATFVVDPEGVVQYAAFHNLRVGRSISEIVRVLEALETGEKA
    PAEWRPGAPTLGR

    >gi|220916445|ref|YP_002491749.1| heavy metal translocating P-type ATPase [Anaeromyxobacter dehalogenans 2CP-1]
    MRCDHCLLEFPEREAVRAEVAGAPKVFCCAGCRGVFELIQGEGLGAYYDSRRWTEVGPQAAAALDLAAFREAVREGHGAA
    ELDVAIDGIR
    CASCVWLNEKLLQRTPGVLSARVNYATHRARIRFDPAAVGLERVLGRIQAAGYQPKPWSDAEQLRARRAE
    AKDLLVRLGTALFLASQLMIYQAALYAGYFQGIDAPTRRLMEWISLGLTLPVVFYSGAPFLRATWRGLRHLRFNMDSLVV
    IGSLAALAYSVHGMLRGGEVYFDTAAMIPTLVLVGRYVEAAAKGRASEAVARLASLAPREARRLEPGPGGRAERRSVPVA
    EIRPGDRIEVIPGERIPLDGVVREGASEVDESLVTGESRPVAKGAGAAVIGGTVNQHGALVIEVTRVGKDTVLAGIVRAV
    EEAQAQKPRIQAVADRVVGGFVPAMLVLAALTVAAWLARGVPVERALMTGISVVVIACPCALGLATPIAVLLSTGLASAR
    GLLVKGGDVVERAGRATDVLLDKTGTVTRGRPALRAIVPLDPAVGADQALALAAAVERRSEHHVGRAVAEAARALPAGAE
    PEAAGFRAVPGRGVVAEVGGAEVLVGNRALLAERGVALAPEADARARELEAHGDTAAFLARGGRALALLAVADPIREEAP
    AAIAALRALGLRVVIVSGDGRVTTGAVAAALGVEAVAEASPVDKREAVAARQRAGRRVLFAGDGINDAPALTQAEVGAAM
    GRGADVTMESADAVLVRDDLRLLPDLVRLSRRTYAVIRQNVFWAFFYNAVAIPLAMAGLLHPIVAAGAMAASSLFVVGNS
    ARLRRAL

    >gi|220916562|ref|YP_002491866.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
    MASNDVVVLQDSTFEQEVLKSETPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQNVPQQYGIRSIPTL
    LVFKGGRVVDTVIGADKTRLEDSVKKAIG

    >gi|220916845|ref|YP_002492149.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Anaeromyxobacter dehalogenans 2CP-1]
    MATDLDVLVLGSGQAGVPLAARLAAAGRRVALVERGDLGGTCVNAGCTPTKTLIASARAAHVARTAGRLGIRAGEVQVDL
    GAAMDRKDAVVARWREGVRQRLEAAAPRLRLVHGPARFVAPREVEVAGERLAAPVVIVNVGARPAVAPVPGLDRVPFLTS
    TGALALRALPAHLVVLGGGYVGCELAQLFRRFGAGVTVIDPSPHLLAREDEAVSAALEEVFRREGIRLALGAAAEAVEGG
    AGAVRVRLAGGAVEEGSHLLVATGRRPNTDDLGCDAAGVALDRRGFVEVDARYCTSAEGVYAVGDAAGGPQFTHSAWDDH
    RILFDLLLGRGRRTRDDRLVPHVVFTDPQVGVVGLTEREARARGVPFELATLPYSAVARAVEVDEPDGVVRVLVDPRDER
    ILGAAVVGAEGGELVHVLAALMQAGASARALVDMEMAHPTFCEGLQSAVMTLERFALRP

    >gi|220916850|ref|YP_002492154.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
    MASGVMDIGDAEFEREVLSAAEPVLVEFTAAWCAPCRALAPTLEALASGYRGRVKVAALDVERHPATAERYGIRAMPTLL
    FFKGGAVARQLVGAVPRARLEDVVRELLPR

    >gi|220917048|ref|YP_002492352.1| glutaredoxin 3 [Anaeromyxobacter dehalogenans 2CP-1]
    MSAPRITVYTKQNCPYCVRAKRLLEKKGVAFEEISVEGKDELRTWLAEKTGQLTVPQIFAGERSLGGFSDLDALEQRGEL
    DPILRGG

    >gi|220917175|ref|YP_002492479.1| peptide methionine sulfoxide reductase [Anaeromyxobacter dehalogenans 2CP-1]
    MFATKTTLPAAGEALPGRAEPMPVPERHFVNGDRIVPPFPAGLELADFGLGCFWGAERVFWKLPGVYATAVGYAGGETPN
    PTYREVCTGRTGHAEVVRVVFDPARITYADLLKVFWESHDPTQGMRQGNDVGTQYRSAIHVHGEAQRRLADASREAYQAA
    LAPRGGGAITTEIRAAPPFYYAEEYHQQYLAKNPEGYCGIGGTGVSCPGFAAR

    >gi|220917188|ref|YP_002492492.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MNGRLKLVLVALLAVVAFQVFFRGRGAPRSQGGGHPAPPLALPDLAGRTVDLEALRGKVVAVNFWASWCGPCRAEIPDLA
    EVWRAHQGKCFELLGVAEESGREDVLAMARGIPYPILIDARATALEPWGVPAYPRTYLVDAQGTVQHVFAGTLDRETLTA
    ALQPLLPASCPKG

    >gi|220917211|ref|YP_002492515.1| dihydrolipoamide dehydrogenase [Anaeromyxobacter dehalogenans 2CP-1]
    MPTQTYDAIVIGAGTGGYPAAIRLAQLGKKVALIEKDATLGGVCLNWGCIPSKALIAAANLVDEMRGAADRGIIAEPPRV
    DVAKLREFKDGVVKKLTGGVALLEKGNGVEVVRGTATVVAPNAVEVAGKDGQKTRLEAGAILVATGARPIEIPGFAFDGK
    DVWSAREAVDLPEVPKRLVCIGGGIIGMELGTVYAKLGAQVTFVEALPQVLTGVDPDAVRLVQKGLRQRGVAVHVNAKAK
    GYERRGKELVVKIEIEGKEQEIPCDKILVAVGFKPSSAGFGLEQVGVKIGPKGFIEVDQQYRTSVPTIFAAGDVTGPPLL
    AHKASKEGEIAAEVIAGHKTVRDWVGMPTAIFTDPEVAAVGLSEEEARKQGYDPIVGKFAFGALGRAIAIHHTEGFVKVV
    GDRKTKLLLGASICGPEAGDLIAEAALALEMGAYLEDVALTIHAHPTLPEALNEACRAALGEAIHMLNRPERPKKGEAAA
    GARA

    >gi|220917403|ref|YP_002492707.1| rhodanese-like protein [Anaeromyxobacter dehalogenans 2CP-1]
    MIRFLRLTVLAAAALAAGAGARAEDAPYREASVDEVARLLGTPGARVFDANGPETYAKAHLPGATLVAYRTYEARELPAD
    KDAPLVFY
    CKNTR

    >gi|220917442|ref|YP_002492746.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
    MAHATVEITSQNFKDVVEKDGIVLIDWWATWCGPCRSFGPTYEKVAGKHPDLTFGKVNTEEQQELAAAFDIRSIPTLMIL
    RDKVLLFSQAGALPEAALEDLIRQVRALDMDKVRADVAAQEAEAAKRSSASA

    >gi|220917496|ref|YP_002492800.1| glutaredoxin [Anaeromyxobacter dehalogenans 2CP-1]
    MADVVEIYGKDACPYTAAARREYATRGLEVRYFDVLRDRAAMARFLELSGGERQVPLIVERGRVSSGFGGS

    >gi|220917517|ref|YP_002492821.1| UBA/THIF-type NAD/FAD binding protein [Anaeromyxobacter dehalogenans 2CP-1]
    MTSLSGKRVLVIGAGGLGAPALLTLAAAGVGQLVLLEDDAVETSNLNRQPLFQEADVGRRKAAVAAARLRAIFPSVAVDA
    RDERFDAGNAEALAGGADVIVDGSDNFETKFLANDAATRVKRPLVHAGVLRTTVQLLTVAPSGLGGCLRCLFEAPPPPGS
    VAS
    CSQAGILGPVAGFAGALLAAEALRLLAGERGTYEGRLFTYELRSGRSRLVLVRKRPGCLACAGRQVLGSSAPAACDA
    PAAPAGGAA

    >gi|220917910|ref|YP_002493214.1| protein of unknown function DUF395 YeeE/YedE [Anaeromyxobacter dehalogenans 2CP-1]
    MEQRPYWNPYKAGFLLGLVLLASFVLTGRGLGASGSFKHVVAAGLHAASPTWTEENVSVGRFFADPARASMDDWIVWLTA
    GTLLGGGIAVLTARRFRAETVMGPRADRRWRWVLAGAGGALAGFGAQLARG
    CTSGQALTGGAQLALGSWLFMLCVFGGAY
    ALAWFVRRQWI

    >gi|220917936|ref|YP_002493240.1| Rhodanese domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MPSARLALAAVVVLQALVACSRAPAGPPAAPVVDGPTAKALVDGGARLVDVRTPQEFAAGHAPGAINIPYDEIARRAPGE
    LPDRDASIVLY
    CRSGRRSAIAAKALRELGYARLHDLQRADAWPGPLESTR

    >gi|220917996|ref|YP_002493300.1| glutaredoxin-like domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MALIGKDDAEQIRAELEGALQGDVKLTLVGPSALAPPARDLTPQIRQLLEEVAALSPKLAFEYLDLPTPEQREALGLATD
    EAGPLTLLSGAARGRVRYLGAPAGHEFPNLVNGIIDVSRGESGLSPASREALARISRPVHIKVFFTPT
    CPYCPQAAGLAH
    AIAVESAHVVADAIEAQEFPDLAARYQVMGVPKTIVNDVEEFVGAVPEDEFVAHVLRAAGVPA

    >gi|220918127|ref|YP_002493431.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MTLPLLAMLLGASPLKVGDKAPDFTLPDSDGKPVSLSSLLESGPVILAFYTKAFTPGCTRELSAYRDRYADVANKGAQVV
    GISTDSVETQRKFKDELKVPYRLLSDQGGKVAKLYGGTIPVVGLANRATYVLAQDGTIQEIVTGSAAIDPAGAITSCPLH
    KGKKG

    >gi|220918419|ref|YP_002493723.1| alkylhydroperoxidase like protein, AhpD family [Anaeromyxobacter dehalogenans 2CP-1]
    MQPRIDHGKVAPGALRAMYALEQYVRGSGLDLTLYHLVKLRASYLNGCAFCVDMHTKEARAHGETEQRLYAVPVWRETPF
    FTPRERAALAWTETVTLIGQTGVPDEAFEAARQEFEEAELVNLSMAIVAINGWNRLAVSFRAPVGTYQVGANRAPAEPAA
    QRA

    >gi|220918601|ref|YP_002493905.1| selenide, water dikinase [Anaeromyxobacter dehalogenans 2CP-1]
    MSQTMSEADKTVRLTSLSHGAGCACKIRPADLAQVLRRLPAVDDPRVLVGHSTRDDAAVYALDAERAVVETVDFFTPVVD
    DPYWFGRIGAANAFSDIWAMGARPLFALNLVAWPVKTLPMEMLGEVLRGGAETARLAGAPVVGGHSIDDPEPKYGMAVTG
    LVHPDRVLRNVGARPGDRLLLTKPLGSGIITTAIKRGIAPAPMIDAAVEVMSALNRAAGEVLAESGAVRALTDVTGFGLL
    GHAWEMAEGSGVALRLHAGAVPVLPGVLDLAAKDVLPGGSKANLAWVEPALRVAPGVAEALPAVLADAQTNGGLLAAVDA
    ARAGAVLEALRAAGVAAVEVGEVLPGDPPRIELVP

    >gi|220918629|ref|YP_002493933.1| Redoxin domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MRRPPLAAALLALVAACAAPRTPQRPTPRPPPGPSRLLGTEVSFSAPDLAGRDVQVGGAAARGRVQVVDFWASWCEPCKE
    QLPHLDRLAREHGEDGLRVTGVAFDEDRAAVEAFLAPAPVAFEILWDPGGAALGDRLDVQRLPTTLVIDRRGLVRHVHRG
    YDRAEGEKLEEEVRLLLAEPAP

    >gi|220918722|ref|YP_002494026.1| iron-sulfur cluster assembly accessory protein [Anaeromyxobacter dehalogenans 2CP-1]
    MEATTIAAPAVSSPDLGIPNFVSLTSKAIEMVKDAIAREGLAGYGIRVGVMGGGCAGFQYSMDFEKDPRDGDLSLEQDGI
    KLYVDPMSSMYLQGVTIDYVVGLQGAGFKFNNPNARTTCGCGSSFSY

    >gi|220918738|ref|YP_002494042.1| UBA/THIF-type NAD/FAD binding protein [Anaeromyxobacter dehalogenans 2CP-1]
    MSIGRPASELPELSNEEILRYSRHLIIPEVGVEGQRRLKAARVLLVGAGGLGSPNALYLAAAGVGTLGIVEADVVDVTNL
    QRQVLHGTKDVGRKKLESARERIRDVNPHVKVIAHDAWLTSENALEILSGYDLVVDGTDNFATRYLVNDACVLLGKPNVY
    GSIFRFEGQSTVFCTADGPCYRCLYPEPPPPGMVPS
    CAEGGVLGILPGLVGLVQATEAVKLITGVGEPLVGRLLLVDALG
    MQFRTVKLRKDPRCPACGTREIQALIDYQQFCGIRGDETEQAADGVPSITAGELDARRRRGEDFDLIDVREPHEWEIGRI
    EGARLAPLSTFAEALRTFDSARDLVLY
    CKSGARSARAVRQLQEAGFRRVWNLEGGILRWSEEIDPSVPRY

    >gi|220918742|ref|YP_002494046.1| heavy metal translocating P-type ATPase [Anaeromyxobacter dehalogenans 2CP-1]
    MSTSADSTVRGREPATSPGVAVEASPADRRARVTINVSGMTCAACQARVQKALSGAPGVLDASVNLMTAEAAISYDPAVA
    APEALIERVRSTGYGAALSEPGADALEQQDAARAKEFRELRARALVALAAGAVAMVASMPLMAAHAHHGLGAPTDPFMRW
    SMRVLDPVLERALPWLYAIPEQVLSYGLLALTTAVMAWAGRHFYTRAWAAFRHHSADMNTLVAVGTGAAYLLSLAATVAP
    GFFTSRGVPPDVYYEAVVLIIALILVGNTMEARAKRQTSVALRKLMQLQPRAARVVRGGAEVDVPVEDVREGDVVVVRPG
    ERLPVDGELVSGTSAVDESMLTGEPLPVEKRAGDRVIGATVNGTGSFRYRATGVGADTVLAHVVKLMREAQGSRAPIQKL
    ADRISGIFVPVVLSISIATFVVWFVAADAAPAVRALVAAVAVLVIACPCAMGLAVPTAVMVATGKGAELGVLLKGGEALE
    RAHAVDTVVLDKTGTLTLGKPAVTEVRLAPGAPVDEDALVGLVAAVERASEHPLAAAIAAHATARGTAVPQVDAFESVTG
    RGARGLVGGRRVVVGNAALLEAEGVSTAPLEAEAGELAAKARTAVFAAVDGRLAGLLAVADELRPTSRDAVARLRRMGLE
    VVMLTGDVRRSAEAVARAAGVERVVAGVLPEGKVAEVERLQAEGRVVAMVGDGINDAPALARAEIGIAMGSGTDVALEAA
    DVTLMRPDLRAVADAIALSRRTMRTMRQNLFWAFAYNVVGIPVAAGVLFPAFGLMLSPVLASAAMAFSSVSVVTNSLRLR
    RFRGA

    >gi|220918754|ref|YP_002494058.1| thioredoxin [Anaeromyxobacter dehalogenans 2CP-1]
    MASPLIYRCARCGAMNRLAPLTPGREPVCGKCKADLDTSGAPGHADLAALERAVGSSPAPVLVDFWAPWCAPCRAFAPVL
    ERLAREQAGRLVVLKVDTEASPAAGARFGIQAIPTLVVFRDGKEVDRVSGALPYEELRRFTTAATLGVAG

    >gi|220918762|ref|YP_002494066.1| Rhodanese domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MRFGPLIPAPALLTSLQDVRLLDARPGLEAYAAGHLQGALHADLNVHLSTASAPGFDPARGGRHPLPEPAAWAAQLGAWG
    IGPDTRVVVYDAAGGQNAAARLWWMLRAFGHAQVAVLDGGFQAARDVGVPVTTAAPAPAPAPRAYPAARWSLPILSIDEV
    TSRLGDPAWKVLDVRARERWRGETETLDPVAGRIPGTLNLPSAENLGPDGRFLAPEALRRKYLALLGGTPPEHLVVH
    CGS
    GVTACHTLLALDAAGLGGAALYVGSFSEWCRSGRPIGKG

    >gi|220918868|ref|YP_002494172.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
    MTVSRSILLAALAALGLAGLPACKTAAPAPGAPAAAAPAGAAPAATADPLAGVDLDDLTPEQRAIVRDWASRAFCYCGCP
    HTVTSCLRTHQPCKHAARMARLAARLVAAGAGPSALPGLVDDYYASFDRRMALATDGFGPPLGDPAAPVTLLEFSDFT
    CP
    FCRGLRPALERFVEEHPGRVKLVFKPFPIEAHPGALEAAQAGEWARDQGIFWPLHDALFEAAAPLDVDAIAAAAREAGGD
    AGDLRDALASRKYLDKIRASQAEARAAGLRGTPTLFLNGRYLALPDFSPAMLLHALEDEEEWQQHQGWEKD

    >gi|220919129|ref|YP_002494433.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaeromyxobacter dehalogenans 2CP-1]
    MRLRVSDRAPDVALEGVDGGRLECSRPGAPAVVLFTRYAGCPVCQLEVARIASAMPEFRARSCGVWMVFQSTAEHLRAAM
    AEWKPGFAAVADPTAHLYEAFGVEASVAGYLAPGSLLALVRATMAGKRHGRFEGRETQLPAGFVLDPTGRIALAHYGRSV
    GDDAPVSALLGALDSLNNGADQRVRPVP

    >gi|220919173|ref|YP_002494477.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
    MRNVVLGALAVLAAACQSPRPAQPAQQKENPSAPVAKVGGQAITTGELDELVKSDLKQLEQQYEEQKYQLKRQGLESMIR
    RRVFEAKAKAEGITPDELVNRDVVAKIPEPADDEVRALYERAKAGGQQLPPIDQVKPDIARFIKNQKAQAELTAYYEKLK
    KDMNVEVLLPAYMPPKVEVAATGPSKGPNDAPITIVEFSDFQ
    CPFCVRAEPTVKDVMAAYPGKVRVVYRDFPLPSHDLAP
    KAAEAAHCAGDQGKYWEMHDRLFAANGKLAVDDLKGYAREVGADGAKFDRCLESGEKAPVVQEHHKAGEAAGVSGTPAFF
    INGRLISGAQPLEAFKAVIDQELKAAGKQ

    >gi|220919174|ref|YP_002494478.1| thioredoxin reductase [Anaeromyxobacter dehalogenans 2CP-1]
    MSKHERLVIVGSGPAGYTAALYAARANLQPLLFEGMQPGGQLTITSEVENFPGFPEGILGPELMEKMKKQAERFGTRFEA
    SEITRVDFSQRPFKLWQDDTLYTADAVIVATGASAKWLQIPSEKQYQGRGVSA
    CATCDGFFFRGVEIAVVGGGDTALEEA
    SFLTKYASKVHVVHRRGELRASKIMQDRARKNPKIELVLNAVVDEILGDGKAVTGVRLKDTRDGSTRELPLKGVFMGIGH
    EPNTGIFKGQLEMNEVGYLAVKAPSTATSVPGVFAAGDVSDPHYRQAISAAGTGCSAAIDAERWLGEHVTESWN

    >gi|220919243|ref|YP_002494547.1| Rhodanese domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MIRISTEEAAQRIAQGGYDLVDVREPHEWAGGHIPGARHVPLGALARAPADHLTRDRVIFVCGHGMRSQTACAIARSAGL
    SEVFSVDGGVVGWAAEGRPLSP

    >gi|220919262|ref|YP_002494566.1| Redoxin domain protein [Anaeromyxobacter dehalogenans 2CP-1]
    MSTRSVRPAAALAALVALVGLAACKESRPAVSQAELDRFGIERATSVPAPPIELISLDGTRFSLASAKGQVVFVNFWATW
    CPPCRTEMPSMLALGRELEAKYPGKFRMVAVSVDEAWDPVREFISAPPYMGSTAGATVVLDADQSVTMRYYCAARGGCPD
    SYKFPESYIVGKDGKLVSMVIGPREWSVPVARAYLEQLIGS

    >gi|220919271|ref|YP_002494575.1| DSBA oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
    MKHVSWVVALVIGFAIGFVGRGSWDAGGRPSRAPVGAPTRARPVEDPKAVYRVPADDSPVRGPADALVTIVESSDFQCPY
    CKRGAATMKQVEEAYRGKVRFVFKHNPLSFHPQAMPAALAAEEARAQGGDEKFWALHDKLFDSAPALDQAAIEKAAGELG
    LDVAKVREAMQAGTHRARIERDQKLVVGLGAPATPTFFVNGRKIAGAQPIEAFRAVIDEELARAEQLVRSGTPASQVYAK
    AIERGATAPVFLPGTVPPPTAAAPSPAAPAPAAPAAPPPATYAKVPLRADDPARGPADAKLTVVLFSDFQ
    CPFCSRVEPT
    LKQLEQAYPGQVRIVWKHQPLSFHPNAMPAAIAAEAAREQGKFWPMHEKLFSNQQALSPATYEQYAKELGLDLRKFQAAV
    AARKGADRIAADQQLAGSVGANGTPTMFFNCRQVVGALPLERMRPVVEEELKKADALLKGGKAGAGFYEQACQANLALKP
    AAPQQGAVVPAALPAGQPVQGLAVRADDPIRGNPKAPVTIVLFSDFQ
    CPFCARVEPTLAQVQKTYGDKVRVVWKHQPLGM
    HPNALPAAEAAEAAREQGKFWQMHEKLFASQRELSDALYERAAREIGLDVARFDAARRSGRARTRIAEDQALAARIGAQA
    TPTMFVNGVKVEGAVPFEQIRAVVDAELARR

    >gi|220919300|ref|YP_002494604.1| OsmC family protein [Anaeromyxobacter dehalogenans 2CP-1]
    MASETFVTFPGGKRVDTTIGNHVIRTDQPVASGGEDSAPSPFNLFMAAIGTCAGIYVLGFCQKRELPTDGIRLRQRAHFD
    PETGVLARVELDIEVPPTFPEKYREALVRVADQCAVKKAIQAQPAFEVKTVVAAG

    >gi|220919395|ref|YP_002494699.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anaeromyxobacter dehalogenans 2CP-1]
    MASPSRTGLYFCRCGPNLGRAVRLPDLSAPGAFPAAADVAVHDVLCSPEGQAWLAERIRAGGIERVVLGACSPREHEHTF
    RGVLAGAGRSPWQLHMVNLREQAEWLGGAPADVTARARRLVAAGLARVALQRPLPEGDVEVSADALVVGGGAAGISAALA
    LAQKDRKVVLVERAHALGGLANRLDEVFPELACAS
    CFMEPALDRVLHSDRIEVLTGAEVRRVRGSAGRFTVELVVAPRHV
    DPAACLGCAEVCGAACPVEVADPSGGEPARKAIHLPYAGCLPHAAVVDRAACPPGCAACAGACPFGAVRLDDAPRSREVE
    VGAIVIATGLEPGAVEGPEGLVSSWQLERMLHPDGPTGGALRGAGGRTPEAVLLATSAAEADGELALREVLKLAQRVRAR
    LPSARVAVAGGLDRAPQLVGLAAALRREGVELLPGALVEGGVAAADGALEVRLAEPGGGATRRRADLVAIHAPSRGAGGA
    ASLAALLRLAPDRRGFLADGGASPFEPTATRTAGVYVAGAAAGPRSIRDAIRDGAAAAGQVLATLRPGERRALEPLAAEV
    DAALCGGCGMCVAACPFGAMVIDGADGKATVLAVDCRGCGTCAAACPTGAASARHFTRAQIAAEISALLAGR

    >gi|220919451|ref|YP_002494755.1| arsenate reductase [Anaeromyxobacter dehalogenans 2CP-1]
    MSGEYVLWFDPRCSASRRALSLLRERGVEPALRRPLEEPPSADELAALLRALGLPARAVARRDEDEYQVLRLSDRTPEAE
    LVEALAAHPRMLERPILVAGARAVLARPPERVLELLGPP

    >gi|220916791|ref|YP_002492095.1| OsmC family protein [Anaeromyxobacter dehalogenans 2CP-1]
    MAFEVETRSLQGCVTAVGSAGGHTVVIDRPEAAGGGGLGFNGGELLHLAVAGCVSNDLFREALAAGIRLESVRVRVRGDF
    AGEPAVSTGIRYDVEIAGDASEERLAELVARVDRIAEIPGTLRRGAAVQLGEANVRRSTRA

    >gi|220915457|ref|YP_002490761.1| alkylhydroperoxidase like protein, AhpD family [Anaeromyxobacter dehalogenans 2CP-1]
    MAALDAIREALPEPARDIKLNLQAVLQPGTLTPAQRWGVAVATAAAARNERLLAAALADARAEVEPAVIEDALAAAAVMA
    MNNVYYRFRHMVGKASYAEKPARLRMNRLVKPAASKVDFELFALAVSAVNGCET
    CVRSHEQVVVAGGLSEDQVHEAVRIA
    AVLHAAAVSLELAGYAAVPSAAAAAG