Lactobacillus crispatus ST1 uid48359

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295692116|ref|YP_003600726.1| Methylated-DNA--protein-cysteine methyltransferase [Lactobacillus crispatus ST1]
    MQTVSYYNSPIGKILLASDEQGLIGLWLDTDRYYGDNLDKEYSEGGNKYLASAKKWLDIYFQGKEPDFTPQLHLIGTDFQ
    KRVWQALLKIPYGMTTTYKDIAVQAAKDKDHLPIRAAGGAIGRNHICIIIP
    CHRVVGVNHNLTGYGGGIDKKIQLLKLEG
    VDINQFKEP

    >gi|295692281|ref|YP_003600891.1| Thioredoxin [Lactobacillus crispatus ST1]
    MVEAINDQNFEEETKNGVALVDFWATWCGPCKMQSPVIDQLSEERQDVNFYKMDVDQNQDTAKNLGIMAIPTLIVKKDGN
    IVDRITGYTPKEKLNQILDQYTD

    >gi|295692373|ref|YP_003600983.1| NADH peroxidase [Lactobacillus crispatus ST1]
    MSKKQIVIVGASHGGQEAAYEILDRYDDVDVTVYEASDFVSFMSCGMKLYLEGKTTGQDNVRNFTPEGLAERGGKVVNNT
    AVTALDPTNKTVTVKNVKDGSTKEVNYDKLIISSGVNPAGLPLPGADLKNIMLMRGYD
    CASEINAVAQNDAVKNVAVIGA
    GNGIAAAEVFAKAGKNVTLIDSGHKPLENYLNDTYTDLFAKELTDHGVNLAMDTKVTGFAGDGKVEKVETDHGEIATDCV
    IITVGIKPNTAWLKGTVDLYDNGYIKVDNYFRTNVKDVYAIGDAVFPFSIPANRRVPMPSAIAVRHEAQYVVEHLFEAKP
    ECVFKGLVGAQLLEAFDLHAVTTGLSEKNAKRAGINAKETVLKSYLRPDYIPEKDNPTCYIAVVYNEDSHQILGGSVLSS
    YDISGQANVLSLAIRNKLTLEDLAEADFFFSPTYDKQWSLVNQVAQKALGLKLTV

    >gi|295692515|ref|YP_003601125.1| Arsenate reductase related protein, glutaredoxin family [Lactobacillus crispatus ST1]
    MVDLYVSPSCTSCRKARAWLEKHNIPFEERNIFSEPLTKKELLKILRMTENGTEEIISTRSRTFQQLRINLDDLSIDQLL
    DLVEKNPSLLRRPIIMDDRRLQVGYNEDEIRRFLPRKVRRLELAEAQKIADL

    >gi|295692550|ref|YP_003601160.1| Thioredoxin reductase [Lactobacillus crispatus ST1]
    MADKYDVIIIGAGPGGMTAGLYAARANLKILVLDRGPYGGQMNNTDAIDNYPGFSEIKGPELSQKMYDTMMKFEPDYKYG
    NVQSVELDGEDKLVKTDDGNEYRAPIVIIATGSDHKHLNVPGEEEYSGKGVSY
    CAVCDAAFFKDEDVAVIGGGDSAIEEG
    IYLSQLAKSVTVIHRRDQLRAQPTLQKRAFANKKMHFIWNAQTEEILGDDMKVTGVKYRDKETGAEKEIPVAGVFIYVGV
    LPQTEPFKDLGILDDHGWIVTDDHMETKVPGIFALGDVRQKDLRQIANAVGEGSVAGQAAYNYYQDLQDKKN

    >gi|295692805|ref|YP_003601415.1| Thiol peroxidase [Lactobacillus crispatus ST1]
    MKVTFKGKEVELIGTPPKVGDEMPNFTVLDKNKQEVTKDNLLGKNTLISVVPDINTSVCSIQTKTFNKTMDRFPDVNFLT
    ISTNTIKDQQNWCAAEGIKNMQLMSDEKLSFGKATGLLIPESGILARSVWILEPNGKIVYREIVDEITHEPDYNTAVNEL
    KKLL

    >gi|295693082|ref|YP_003601692.1| Copper chaperone [Lactobacillus crispatus ST1]
    MKKVIMKLSGMTCPSCLSKIERAVGSLDGTDQIKVLFNAGKLKFTLDPDKTKTVDVKTAIEKMGYEVQGIKEKELN

    >gi|295693087|ref|YP_003601697.1| Peptide methionine sulfoxide reductase [Lactobacillus crispatus ST1]
    MTENNKQAEGTDTKAKANYDTAIFAGGCFWCMVEPFDTVDGVEKVVSGYTGGHVANPTYEQVCSGTTGHTEAVEITFDPA
    KISYDQLLNYYWQVTDPTDAMGQFQDRGDNYRPVIFYNSPAQKEAAEKSKQRLQASGRFDKPIVTKIEPAKPFYPAEEYH
    QDFYKKDPLRYEMEEAGGRAKFIKEHWD

    >gi|295693121|ref|YP_003601731.1| Oxidoreductase protein [Lactobacillus crispatus ST1]
    MKNVKNIIIGFGKGGKTLAKFLAQKGEEVLVVEKSDKMYGGTCINIACLPSKRLIIEADNGVDFVDAVNGKNDMTSMLRN
    KNYHMLADEENVTVLDGTAKFMNNHEIAVTTVNGQIEEFHGDRIFINTGALPVMLPIPGLMESNAILDSTAAMDQTNLPK
    KLVIIGAGYIGLEFASMFAEYGSEVTVLDLHDNFLPREDDDIAVEIKHDLENSGVKFELGVKISRIDDHTVYYEKDGVTT
    TTVADRILVATGRKPNTEDLGIENTDIELTDRGTIMVDDYLRTNVENVWAIGDVKGGPQFTYISLDDFRIIKDQLYGDAQ
    RRVSDRINVYSLRRHYLASA

    >gi|295693218|ref|YP_003601828.1| Arsenate reductase [Lactobacillus crispatus ST1]
    MIKFYGYKRCSTSRKARKWMDDHQVNYEFQDLVEQPPKKEDLVKWMTKYQDRGLKYFFNTHGQDYRRENLKEKVPTMTIE
    EAADMMSKNGKLIKRPLVVDDSNLTCGFKEDIFEQIWL

    >gi|295693227|ref|YP_003601837.1| Peptide methionine sulfoxide reductase [Lactobacillus crispatus ST1]
    MTFNKEEKEQALKRLTDEEYNVTQKAATEYPFTGKYDDFYEKGIYVDVVSGEPLFSSLDKYNAGCGWPSFTKPIKKLTYH
    RDQSHGMERTEVKSPEADSHLGHVFTDGPVDQGGLRY
    CINSAALRFIPYDQLEQAGYGEYKKIFE

    >gi|295693404|ref|YP_003602014.1| Thioredoxin [Lactobacillus crispatus ST1]
    MEKIKELTEDQLKEITKEGRTVLEFSADWCPDCKFLAPFMPEIEKDFSDAKFYEIDRDGSIDIAKKLMIMGIPSFVVYQD
    GKEIGRLVNKDRKTKDEVENFLRSLD