Lactobacillus casei Zhang uid50673

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209401035|ref|YP_002268591.1| putative mercury II reductase [Lactobacillus casei str. Zhang]
    MDKFKNIIIGFGKAGKTLAKYLAQHDETVLLIERSKQMYGGTCINVGCLPSKNLILNGQRGLDFTTAVNKRGEMTRQLRN
    KNYHMVADEPLATVWDGSARFIDNYVLAVVMSDGTTKKVRGERIFINTGAVPNWPSIPGLEFGQRIFTSKEAMELKKQPK
    RLAIIGGGYIGLEFAGMFNSFGTHVTIFDQHTRLLEREDPDIATEVVTDLTNAGIEIKLETQLTQVKDNGEKVTLYYQQG
    DQTNTAEFDAVLVAVGRRPNVSSLGLENTDIALTNRGAIQVDDHLRTTVQNIWALGDVNGGPMFTYVSLDDFRIIIDQLF
    GKGDRSTADRMVIPTASFLNPPLANVGLNEHQAKSVGYNFQTFKLSVKAIPKARVLEDQRGLYKVIVDQKTHLILGATLY
    AAEAHETINLIALAMKAKLPYERLRDMIYTHPTMSEALNDLFKTPVVKS

    >gi|301065205|ref|YP_003787228.1| copper chaperone [Lactobacillus casei str. Zhang]
    MTKLVYQLDGLTCPSCLQKIEGALGQQAGVKTVKALFNSSKVKAQIDPSVTNADALKKTITDLGYTVVNVRSQEA

    >gi|301065280|ref|YP_003787303.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus casei str. Zhang]
    MQYTRLAMPNHAYFIVADQGKLAFVGSPDAPLSEAADYVSGSLEFNQEEMLPFQNAIDDYLTGKAQTITVQVTYHGTPLQ
    EAVWQYLQTIPYGETRTYAQVAAAVGHPHAFQAVGSAVGKNPVMIAVP
    CHRVLRKDGGLGGFRGGLPMKRDLLALEQGQR
    PIF

    >gi|301065293|ref|YP_003787316.1| NADH oxidase [Lactobacillus casei str. Zhang]
    MSKKIIVVGGVAGGASVAARARRLDESAKIIMYEKGPNVSFSNCALPYHLSGMIPNADDIVLMDPVQFKRQYNIDAIVNH
    EVISIDAVNRAVTIKNMQTGETAIDHYDDLFLSPGAVPILPKSIKGIDGSNVFTIRNVDDIKALGDVLKKCSISNISVIG
    GGFIGVETAENLVKGGYHVNLVEGADHILATIDQDMAQVVQKTILDNKVNLIVRDTLTAIGKHSITLASGQELPSDIVIM
    AIGVKADTTLARKSGIKLGKTGSIQVNQSFQTNLPHVYAVGDAIEVYSRLLRRPTRLNLAFPAQLQARQAVDHAYGRQIR
    NRGVIGSQCLPVFNTNVASTGLTAQQCQDAEIDFRSAMVIPKDKVALIPGAKPLYMKLIFAYPSGEILGAQAIGESSVDK
    QIDIIATAITNHNYVEDLETLELCYQPTFSTAKNAVNMAGLVATNILNDEFKQVMVTDVRSLVEAGATIIDVREPDEYAE
    GHIIGAKNIPMSVFRDHLKEIPKDRPVYIH
    CLSGQRSYNVARALGNRGYHNIYNIAGSFLDLCEFEYFEDQTQNRRPIVT
    NYRFDLL

    >gi|301065294|ref|YP_003787317.1| hypothetical protein LCAZH_0171 [Lactobacillus casei str. Zhang]
    MISMGFDRYGLDKRQPIVGFIVLILTIVWAITLNQKAGSLPMALVAGLMIGYTLTRSRYGFAGGVKRIFYRGEGSLTIAL
    LVMLATTALINFGIQWFAASNGAIPAWEITSAKQALIPGTQNVRIGNISVIIGAFLFGMGMIMAGG
    CASGTLSDFGEGEG
    HAWIAFPFFVLFAAPGQYFGYILDNTTIGKIGVNVWLPQYIGYWGALLLTIAILFVLYLITKYYENKKKAAGAWLSPKSD
    WADYEKPIPLDEKHHFKWWSWTTYHKLFIERWSFLTGGIGITLVASFIMITTNKAWGVTTPFVTLDQKIFQLFGMQFHSP
    AFDETAKAMSGPLLMDGGTIRNIGIVLGALIAFLMAGRFKANLKMTWADFSGYAFGGAFMGLGSRMARG
    CNIGALYSSIT
    NFSLHGYIFMFFLVLGAAFAIKLFQGKLDLCPMYMPKKVLKEDITYE

    >gi|301065333|ref|YP_003787356.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei str. Zhang]
    MKVVVVGCTHAGTAAVRELLMKHPETEVDVFERREDISFLSCGIALYLEGTVGRLEDMFYATPASLEALGPHVHVHLKHD
    VLSIDAADHRILAENLKTGNQQHYQYDKLVMATGSYPVVPPISGVSIPRVLMCKNYDDARRIKESAKDAEHIAIVGGGYI
    GVELAEAYSRNHKQVTLINGVSPLLSHYVDLPLSHEISEALTTRGVELKPNTVAKHFDSDEQHVFIQTDKGEIQADLAVV
    CVGFRPMTELLIGQVDMNPDGSIHVNDYMQTSNSDIFAAGDAVAVHFNPTGKDAYAPLATNAVRQGMMVGANLFKPTIKY
    MGTQATSALKLYDHNLGVTGLTLAHAKRNHLSAASVTMTDDFRPPFMPDTVKITMVLVYDTDDRRILGAQFYSQYDIVNA
    ANLISVMIQNRNTIDQLAYVDMLFNPNYDKPWHYLNLLGQLAVTQADNTTA

    >gi|301065405|ref|YP_003787428.1| thiol-disulfide isomerase and thioredoxin [Lactobacillus casei str. Zhang]
    MEGDHIMAIEATKDNLKALTAEGTVVVDFWAPWCGPCKVLDPMLTALEQELPALKVVRYNVEKDHTLPSTMGIMSVPTLV
    IYQQGEAREKVTGVYPKDKLKRYFEQKLEA

    >gi|301065425|ref|YP_003787448.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei str. Zhang]
    MKVLVIGATHAGTFATQQILTEHPDYDVTVYERNSNLSFLSCGIALWVGDHVSDPDKMFYSSPEALAALGANMQMEHDVL
    AIDPAEKTVEVKDLKTGNVTTDTYDKLVYTTGSTPIVPNIPGIHDTDVHL
    CKNWHDAKALKALAPTIKSAIVIGAGYIGA
    ELAEQYALTDKQVTLIDGLPRVLAKNFDANITDRVEKLYTDHGVNLALGEMVTGFTQGTDGEMTVTTDKGSYTADIAVLC
    TGFRPNTELLKDHLETLPNGAVITDAYMQTSDPAIFAAGDTATVHYNPTGKNDYIPLATNAVRQGILVGKNIEKPTEKYL
    GTQSSSAVELFEHAIAASGMTTEGAKARGIEVASVTIEQDYRPDFMLTTTPVLCSLTWDPKTHEVKGGAFFSKHDISQSA
    NVISLAIQTHMTIETLAMVDMLFQPNFDQPINWVNAVAMAAVAKAQEMEKTPVA

    >gi|301065549|ref|YP_003787572.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei str. Zhang]
    MDKPKIIVVGASHGGHQSVLELLHRYPDADITMFEAGDFVSFMSCGMELFLENQVTDVNDVRNFRPDDLIKRGAHVLNNH
    EVTAINADVKSVTVRDTKNGTTQDYPYDKLILSSGVRPNSLPVPGNDLKNVFLMRGYDWATNIKAKLEDPAVKHVTIIGA
    GYIGIEAAEASRKAGKQVTLLDMIDRPLGTYLDPEMTDILAKELTDKGVELKLGVKIEAFTGDEAVSAVKTDAGDVKTDL
    VIQAAGINPATEWLKGTVNLDKRGFINTDPYLRTNLPDVYAIGDATLVYSIPAQQKVPIALATVARREARYLAENIFAEN
    PARPFKGVVGSSALSVFDYHFAASGLNTFTAKRADVNVHTAFYTDSLRPDYVPEANGNPQVCVNLVFDPQTHRLLGGAVL
    STYDVTAQGNVLALAVQQQLSLEDLAEADFFFQPGFDRQWSLLNLAAQHALGEPRF

    >gi|301065574|ref|YP_003787597.1| putative redox protein, regulator of disulfide bond formation [Lactobacillus casei str. Zhang]
    MQDERWNHPLYTATAINDEGLEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRV
    KVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENR
    CPVSKLLKNSGNYTIETVTDFKD

    >gi|301065676|ref|YP_003787699.1| putative redox protein, regulator of disulfide bond formation [Lactobacillus casei str. Zhang]
    MAERSLYHTYVRNENGLVGESYVEGNQGLALGVSSSLIDAPGTNPEQFIAFALSTCFNATIRIVQHREGTAEDSQLRTRV
    DITRDKIGYKFIVDAQILMPSHTREEAQKIVTQALDE
    CPVAKLLKENENVSFRIVDDFTDEPTLGE

    >gi|301065796|ref|YP_003787819.1| peroxiredoxin [Lactobacillus casei str. Zhang]
    MEITRHGEALTTNGTPIELGEQLPTFTVTNAQAKPVTTQDLSKRLTLISVVPDINTRVCSISTKHFNEDMDAFDHTDFYT
    ISTNTPQEQQSWCAAEGVKKMQLLSDQNGDFGKAMGLFVADNHTDARSVWIVDGTGTVKYRELITEQTHEPDYTSALAYL
    EAHQH

    >gi|301065847|ref|YP_003787870.1| thiol-disulfide isomerase and thioredoxin [Lactobacillus casei str. Zhang]
    MVQAVTDSNYKTETDTGVTLTDFWATWCGPCRMQSPVIDKLAESRDDVKFVKMDVDANPETPKSFGIMAIPTLVIKKDGE
    VVEKLVGYQTKDQLESTLNKYTA

    >gi|301065910|ref|YP_003787933.1| glutathione peroxidase [Lactobacillus casei str. Zhang]
    MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLGFPSDQFKQELADGHAAAEAC
    RLKYGVSFPMHDLIKVNGKEAAPLFQYLKTQAPGELGKSIKWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG

    >gi|301065965|ref|YP_003787988.1| thioredoxin reductase [Lactobacillus casei str. Zhang]
    MAKKYDVIVIGAGPGGMTAALYASRANLSVLMLDRGVYGGQMNNTAEVENYPGFKSILGPDLGQKMYDGATQFGAEYAYG
    NVVSVQNRGAVKLVKTDEDEYEAKAIVIATGAEHKKLGVPGEEAYSGRGVSY
    CAVCDGAFFKDRELAVIGGGDSAIEEGL
    YLTQMAKKVTVIHRRDQLRAQQIIQKRAFANDKMHFVWNAQVQEIQGDDMKVTGVKYRDKETGEEHVLPVAGVFIYVGIM
    PMTEAFQDLGVLDEHGWIPTDEHMRTKVPGVFAIGDVRAKDLRQITTAVGEGGTAGQGVFNYIQSLNDTNIEIKA

    >gi|301066256|ref|YP_003788279.1| peptide methionine sulfoxide reductase [Lactobacillus casei str. Zhang]
    MEQDVFLAKVTNLMLAPRTRAFEREQLRQAKHLVEAGRPVAEGWAQLESSLRPLAMRDNLTPDVADFYRAETGDPAGAVQ
    TDLSAHFDRDMPFQERAIFAGG
    CFWCMVEPFVDLPGITAVTSGYTGGHSAHPTYEQVIGGYTGHVEAVEIIFDTRKMSYA
    ALVALYFQLTDPTDALGQFQDRGSQYRPVIFAKDDTQRQIAEAAKAELAASGRYLRPIITAIEPVATFWPAENYHQDFYK
    KNPKRYQMVERTRRQFLQFQRAQGNLRVMLKRRKNA

    >gi|301066363|ref|YP_003788386.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactobacillus casei str. Zhang]
    MVVGDFAIDLDTVVIGSGPGGYVAAIRAAEMGQKVTVIESTFIGGVCLNVGCIPSKALINAGHRYQDALEASTFGIHAKG
    ADLDFTKTQEWKQNKVVHTLTSGVSMLFKKHKIDTIMGTAFLKDDHSLRVMQKDSAQTYTFKNLIIATGSRPIEIKGFKF
    GKRILDSTGGLNLPEVPKEFVVIGGGYIGSELASAYANLGAHVTILEGTSSILPNFEKDMVQLVLNSFKKRGVTVITNAM
    AKEAEDTGKGVKVTYTADGKEQTIAADYVMVTVGRRPNTDDLGLDIVGVETTDRGLIKVDAQGRTNKPNIYAIGDIVPGA
    ALAHKASYEGKVAAEAISGKASAVDYKAMPAVCFTDPELATTGMTVAEAKDKGIKAKASKFPFAANGRALSLAQTEGFVR
    LVTNENGTVIGGQVAGAGASDLISELTVAVEGGLNVEDLALTIHPHPTLSEVIMDDAEVALGLPINI

    >gi|301066440|ref|YP_003788463.1| peptide methionine sulfoxide reductase [Lactobacillus casei str. Zhang]
    MKKETAIFAGGCFWCMVEPFEEQPGILNVVSGYTGGHVANPTYEQVSSHTTGHTEAVEITFDADTISYPQLLDIYWQQTD
    PTDAMGQFQDRGDNYRPVIFVKDDAQREAAEASKTALAASGRFSGPIVTQIEAAKPFYPAEPEHQQFYAKNPRRYALEHA
    QRQAFIDKTWKDQ

    >gi|301066494|ref|YP_003788517.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactobacillus casei str. Zhang]
    MTMNTDLVVLGGGPGGYVAAIRAAQLGMQVVLVEKAKVGGICLHKGCIPTKSLLHSGETLRLMQSAATFGGIIEGKVGID
    FAKIQARKATVVDQLYRGVQGLMKKNKITVLNGTGAVLGPSIFSPVSGTVSVTFDDKSKEDVMIVPKHVIIATGSSPKTL
    PSLPIDEKMILTSNGMLELTALPKKVAIIGGGVIGVEWASLLNDFGVDVTIVEFLDQLVINESQSIARELQKQLENRGIH
    IQLGAKVEQATIKNKQVALTIAEQTDPLIVDKVMVAIGRQPNVEGIGLQNTSIKYSAKGITHNAFYQTTEDHIYAIGDVI
    DTLQLAHVAMKEGIIAVEHMAGLPVAPLNYNDVPRCTYTDPEIASVGYTSSNYPQDRDVKIGRFNFNANAKAIILGDTAG
    FVEVLRDVVTDDIIGVSIIGAHATDMIAEMSDAMYLDASATEIGDAVHPHPSLSEAIQEATLDTHKIAIHK

    >gi|301066517|ref|YP_003788540.1| glutaredoxin-like protein [Lactobacillus casei str. Zhang]
    MRNITLFTRNGCPQCRMTKRYLDTHKIPFTEHNINEEPQYIDYLKQKGFQQVPVLEADGLDSFSGFRPDALKQLAV

    >gi|301066571|ref|YP_003788594.1| hypothetical protein LCAZH_1512 [Lactobacillus casei str. Zhang]
    MSDQFEKESKKDLKKRLSPEAYAVTQEAATERPFTGEYDDFYQDGIYVDIVSGEPLFSSQDKYDAGCGWPSFTKPISKLA
    EHRDQSFGMERVEVRSPSAESHLGHVFTDGPAAKGGLRY
    CINSAALRFIPVADLEKEGYGDYRHLFKSVH

    >gi|301066759|ref|YP_003788782.1| thiol-disulfide isomerase and thioredoxin [Lactobacillus casei str. Zhang]
    MKELGSNAAILNEVKQPGKKMLFFSADWCSDCRFIKPAMPEIEKDFSDYEFIAVDRDKNLEVAQDMGVFGIPSFIAFNDG
    KETGRFVNKDRKTKQQVEDFINGLH

    >gi|301066780|ref|YP_003788803.1| arsenate reductase-like protein [Lactobacillus casei str. Zhang]
    MVILYTSPSCTSCRKARAWLKENKIPFEERNIFSDPLNVDEIKRLLRMTEDGTEEIISTRSKIFQELGINIDDLSTGTLI
    KLVAKYPGLLRRPIMMDDKRLQVGYNEDEIRRFLPRSVRTMELQQAQLLAGF

    >gi|301066863|ref|YP_003788886.1| glutaredoxin-like protein [Lactobacillus casei str. Zhang]
    MAIHFVIYEKPNCESCRLTKRWLAEHGQHFRTTNHRGESNLVDINANDPLKRAWSHQKIVKFREAGYDRFPVVRVRDDAT
    GDVLATWSGFRPEALASWTAINQLG

    >gi|301067184|ref|YP_003789207.1| glutathione reductase [Lactobacillus casei str. Zhang]
    MSEYDFDVLYLGSGHGAFDGAGPLAASGKKVGVIESDMIGGTCPNYGCNAKITLDTPVVLQRMAERMQGIVSGSITINWS
    ELVAHKQAVIKPLPTNIGSNLKQTGVTIIHGHGKFIDPHSITVAGKTYTAENIVIATGRRPHHLDIPGTELAHDSRAFMD
    LKTLPKRIGILGSGYISMEFATIANAAGAEVSVFMHADKALREFHQPFVKAVMADMTKRGVKFIPSADVQALKQTAQGIA
    IQYGDHQEQQVDWVLDATGRIPNDDQIGLEAAGVTFSQRGIPVDDHLRTNVPNIFASGDVLDKPQPKLTPTATFESYYLY
    QLLSGQTTEPIDYPAIPSTVYTTPRIAKVGVTPEEAADGDYQVVRNHIPDDWYHQTDQETMGDSILIFDRDHHLVGATEF
    SAQAEDAINTLLPAIVFHFSKQQMWQMAHIFPSESAAAWHKIR

    >gi|301067506|ref|YP_003789529.1| peroxiredoxin [Lactobacillus casei str. Zhang]
    MSYIGQHLPAFKLNAYQHGDFHEVSDTDLKGKWAVICFYPADFSFVCPTELGDLQDHYERFQAVGAEVYSASEDTEFVHM
    AWAEASPTIKKIQYPMLADPAGKLATALDVRDEASGQAFRGTFIIDPDGVIQAYAVNNFGIGRNADEILRTLQAAQFVAA
    HGDQVCPANWQPGAKTLTPGADLVGKI

    >gi|301067612|ref|YP_003789635.1| glutathione reductase [Lactobacillus casei str. Zhang]
    MAYDYGTIVIGGGPGGLAAAYGLAAKQKVLVVENDLWGGTCPNYGCDPKKMLYRGVEVKNAALRMNGFGISGTAKIDWPS
    LMAFKRSYTTGVPAGTLNGLTHAGITTLYGHAQLLGEHAVKVGSQNVTGEHIVIATGHTPRYPDIPGANLLKTSRDFLDL
    DQLPTSIAFIGAGYVSVELANIAAAAGADVHIIGHSDRLLRAFPKVATEALKPLLAKTGIHFHPNVELTKITPLGTMTHL
    HADNFDLNVDMAITAMGRIANVADLGLANAGIKADTRGIPVDDHLRTAVETIYAIGDVNLKPQPKLTPVAGFEGRYVANQ
    ILGDQAPISYSAIPTIVFGPTELAKVGVSLEAAEAAPDQYTVKHNEMTHWYTYNRVQDPDAQVWTIVDKKTGRLAGAVVL
    ASLAEDLINTFAAAIDTGEKPSDLNKIYAYPSAQSDLQYLF