Lactobacillus casei BL23 uid59237

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|191636892|ref|YP_001986058.1| Heavy metal transport/detoxification protein [Lactobacillus casei BL23]
    MTKLVYQLDGLTCPSCLQKIEGALGQQAGVKTVKALFNSSKVKAQIDPSVTNADALKKTITDLGYTVVNVRSQEA

    >gi|191636960|ref|YP_001986126.1| Methylated-DNA--[protein]-cysteine S-methyltransferase [Lactobacillus casei BL23]
    MQYTRLAMPNHAYFIVADQGKLAFVGSPDAPLSEAADYVSSSLEFNQEEMLPFQNAIDDYLTGKAQTITVPVTYHGTPLQ
    EAVWQYLQTIPYGETRTYAQVAAAVGHPHAFQAVGSAVGKNPVMIAVP
    CHRVLRKDGGLGGFRGGLPMKRDLLALEQGQR
    PIF

    >gi|191636999|ref|YP_001986165.1| NADH oxidase [Lactobacillus casei BL23]
    MKVVVVGCTHAGTAAVRELLMKHPETEVDVFERREDISFLSCGIALYLEGTVGRLEDMFYATPASLEALGPHVHVHLKHD
    VLSIDAADHRILAENLKTGNQQHYQYDKLVMATGSYPVVPPISGVSIPRVLMCKNYDDARRIKESAKDAEHIAIVGGGYI
    GVELAEAYSRNHKQVTLINGVSPLLSHYVDLPLSHEISEALTTRGVELKPNTVAKHFDSDEQHVFIQTDKGEIQADLAVV
    CVGFRPMTELLIGQVDMNPDGSIHVNDYMQTSNPDIFAAGDAVAVHFNPTGKDAYAPLATNAVRQGMMAGANLFKPTIKY
    MGTQATSALKLYDHNLGVTGLTLAHAKRNHLSAASVTMTDDFRPPFMPDTVKITMVLVYDTDDRRILGAQFYSQYDIVNA
    ANLISVMIQNRNTIDQLAYVDMLFNPNYDKPWHYLNLLGQLAVTQADNTTA

    >gi|191637080|ref|YP_001986246.1| Thioredoxin (Trx) [Lactobacillus casei BL23]
    MAIEATKDNLKALTAEGTVVVDFWAPWCGPCKVLDPMLTALEQELPALKVVRYNVEKDHTLPSTMGIMSVPTLVIYQQGE
    AREKVTGVYPKDKLKRYFEQKLEA

    >gi|191637098|ref|YP_001986264.1| NADH oxidase [Lactobacillus casei BL23]
    MKILVIGATHAGTFATQQILTEHPDYDVTVYERNHNLSFLSCGIALWVGDHVSDPEKMFYSSPEALAALGANMQMEHDVL
    AIDPVAKTVEVKDLKTGNVTTDTYDKLVYTTGSTPIVPNIPGIHDTDVHL
    CKNWHDAKALKALAPTIKSAIVIGAGYIGA
    ELAEQYALTDKQVTLIDGLPRVLAKNFDATITDRVEKLYTDHGVNLALGEMVTGFDQGTDGEMTVTTDKGSYTADIAVLC
    TGFRPNTELLKDHLETLPNGAVITDAYMQTSDPAIFAAGDTATVHYNPTGKNDYIPLATNAVRQGILVGKNIEKPTEKYL
    GTQSSSAVELFEHAIAASGMTTEGAKARGIEVASVTIEQDYRPDFMLTTTPVLCSLTWDPKTHEVKGGAFFSKHDISQSA
    NVISLAIQTHMTIETLAMVDMLFQPNFDQPINWVNAVAMAAVAKAQEMEKTPVA

    >gi|191637287|ref|YP_001986453.1| NADH peroxidase [Lactobacillus casei BL23]
    MDKPKIIVVGASHGGHQSVLELLHRYPDADITMFEAGDFVSFMSCGMELFLENQVTDVNDVRNFRPDDLIKRGAHVLNNH
    EVTAINADVKSVTVRDTKNGTTQDYPYDKLILSSGVRPNSLPVPGNDLKNVFLMRGYDWATNIKAKLEDPAVKHVTIIGA
    GYIGIEAAEASRKAGKQVTLLDMIDRPLGTYLDPEMTDILAKELTDKGVELKLGVKIEAFTGDEAVSAVKTDAGDVKTDL
    VIQAAGIKPATEWLKGTVNLDKRGFINTDPYLRTNLPDVYAIGDATLVYSIPAQQKVPIALATVARREARYLAENIFAEN
    PARPFKGVVGSSALSVFDYHFAASGLNTFTAKRADVNVHTAFYTDSLRPDYVPEANGNPQVCVNLVFDPQTHRLLGGAVL
    STYDVTAQGNVLALAVQQQLSLEDLAEADFFFQPGFDRQWNLLNLAAQHALGEPRF

    >gi|191637313|ref|YP_001986479.1| Putative organic hydroperoxide resistance protein [Lactobacillus casei BL23]
    MQDERWSHPLYTATAINDEGLEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRV
    KVAFIGTRAEYQFLVHAQVMVKGVDFDTAKTFTNEIENR
    CPVSKLLKNSGNYTIETVTDFKD

    >gi|191637395|ref|YP_001986561.1| hypothetical protein LCABL_05780 [Lactobacillus casei BL23]
    MKRVGYGYVSHTEQAIIEKLSREEKHMQAIIYTKPHCQKCRRTVFKLSRVMPVQTITADADDYERFRKLGYRSMPVVTIY
    EADGTHDEWCDLRVDKIKQYTEGNI

    >gi|191637415|ref|YP_001986581.1| hypothetical protein LCABL_05980 [Lactobacillus casei BL23]
    MKHPFRHFLINTVIGVVIATASLSALYVYAPKAMINVATPITINAQKKDQYILYYSPTCPVCQQVYRTYFWRSVTGQLKF
    ASVTNEQNREAAAALGITKVPTLVHYKKGKVVTQYTGQREQQIDKVLAGGKAGEH

    >gi|191637515|ref|YP_001986681.1| Organic hydroperoxide resistance protein [Lactobacillus casei BL23]
    MAERSLYHTYVRNENGLVGESYVEGNQGLALGVSSSLIDAPGTNPEQFIAFALSTCFNATIRIVQHREGTAEDSQLRTRV
    DITRDKIGYKFIVDAQILMPSHTREEAQKIVTQALDE
    CPVAKLLKENENVSFRIVDDFTDEPTLGE

    >gi|191637623|ref|YP_001986789.1| Thiol peroxidase (Hydroperoxide reductase, Peroxiredoxin) [Lactobacillus casei BL23]
    MEITRHGEALTTNGTPIELGEQLPTFTVTNAQAKPVTTQDLSKRLTLISVVPDINTRVCSISTKHFNEDMDAFDHTDFYT
    ISTNTPQEQQSWCAAEGVKKMQLLSDQNGDFGKAMGLFVADNHTDARSVWIVDGTGTVKYRELITEQTHEPDYTSALAYL
    EAHQH

    >gi|191637668|ref|YP_001986834.1| Thioredoxin [Lactobacillus casei BL23]
    MVQAVTDSNYKTETDTGVTLTDFWATWCGPCRMQSPVIDKLAESRDDVKFVKMDVDANPETPKSFGIMAIPTLVIKKDGE
    VVEKLVGYQTKDQLESTLNKYTA

    >gi|191637784|ref|YP_001986950.1| Glutathione peroxidase [Lactobacillus casei BL23]
    MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLGFPSDQFKQELADGHAAAEAC
    RLKYGVSFPMHDLIKVNGKEAAPLFQYLKTQAPGELGKSIKWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG

    >gi|191637840|ref|YP_001987006.1| Thioredoxin reductase [Lactobacillus casei BL23]
    MAKKYDVIVIGAGPGGMTAALYASRANLSVLMLDRGVYGGQMNNTAEVENYPGFKSILGPDLGQKMYDGATQFGAEYAYG
    NVVSVQNRGAVKLVKTDEDEYEAKAIVIATGAEHKKLGVPGEEAYSGRGVSY
    CAVCDGAFFKDRELAVIGGGDSAIEEGL
    YLTQMAKKVTVIHRRDQLRAQQIIQKRAFANDKMHFVWNAQVQEIQGDDMKVTGVKYRDRDKETGEEHILPVAGVFIYVG
    IMPMTEAFQDLGVLDEHGWIPTDEHMRTKVPGVFAIGDVRAKDLRQITTAVGEGGTAGQGVFNYIQSLNDTNIEIKA

    >gi|191638097|ref|YP_001987263.1| hypothetical protein LCABL_13220 [Lactobacillus casei BL23]
    MKRVGYGYVCNTEQAIIEKLSREEKHMQAFIYTKPRCQKCRRTVLKLSRVMPVQTVTADADDYERFRKLGYRSMPVVTIY
    KADGTHDEWCDFQVDKIKQYTED

    >gi|191638194|ref|YP_001987360.1| Peptide methionine sulfoxide reductase [Lactobacillus casei BL23]
    MEQDVFLAKVTNLMLAPGTRAFEREQLRQAKHLVEAGRPVAEGWAQLESSLRPLAMRDNLTPDVADFYRAETGDPAGAVQ
    TDLSAHFDRDMPFQERAIFAGG
    CFWCMVEPFIDLPGITAVTSGYTGGHSAHPTYEQVIGGYTGHVEAVEIIFDTRKMSYA
    ALVALYFQLTDPTDALGQFQDRGSQYRPVIFAKDDTQRQIAEAAKAELAASGRYLRLIITAIEPVATFWPAENYHQDFYK
    KNPKRYQMVERTRRQFLQFQRAQGNLRVMLKRRKKA

    >gi|191638312|ref|YP_001987478.1| dihydrolipoamide dehydrogenase [Lactobacillus casei BL23]
    MVVGDFAIDLDTVVIGSGPGGYVAAIRAAEMGQKVTVIESTFIGGVCLNVGCIPSKALINAGHRYQDALEASTFGIHAKG
    ADLDFTKTQEWKQNKVVHTLTSGVSMLFKKHKIDTIMGTAFLKDDHSLRVMQKDSAQTYTFKNLIIATGSRPIEIKGFKF
    GKRILDSTGGLNLPEVPKEFVVIGGGYIGSELASAYANLGAHVTILEGTSSILPNFEKDMVQLVLNSFKKRGVTVITNAM
    AKEAEDTGKGVKVTYTADGKEQTIAADYVMVTVGRRPNTDDLGLDIVGVETTDRGLIKVDAQGRTNKPNIYAIGDIVPGA
    ALAHKASYEGKVAAEAISGKASAVDYKAMPAVCFTDPELATTGMTVAEAKDKGIKAKASKFPFAANGRALSLAQTEGFVR
    LVTNENGTVIGGQVAGAGASDLISELTVAVEGGLNVEDLALTIHPHPTLSEVIMDDAEVALGLPINI

    >gi|191638442|ref|YP_001987608.1| Dihydrolipoyl dehydrogenase [Lactobacillus casei BL23]
    MTMNTDLVVLGGGPGGYVAAIRAAQLGMQVVLVEKAKVGGICLHKGCIPTKSLLHSGETLRLMQSAATFGGIIEGKVGVD
    FAKIQARKATVVDQLYRGVQGLMKKNKITVLNGTGAVLGPSIFSPVSGTVSVTFDDKSKEDVMIVPKHVIIATGSSPKTL
    PSLPIDEKMILTSNGMLELTALPKKVAIIGGGVIGVEWASLLNDFGVDVTIVEFLDQLVINESQTIARELQKQLENRGIH
    IQLGAKVEQATIKNKQVALTIAEQSDPLIVDKVMVAIGRQPNVEGIGLQNTSIKYSAKGITHNAFYQTTEDHIYAIGDVI
    DTLQLAHVAMKEGIIAVEHMAGLPVAPLNYNVIPRCTYTDPEIASVGYTSSNYPQDRDVKIGRFNFNANAKAIILGDTAG
    FVEVLRDVVTDDIIGVSIIGAHATDMIAEMSDAMYLDASATEIGDAVHPHPSLSEAIQEATLDTHKIAIHK

    >gi|191638464|ref|YP_001987630.1| Ribonucleotide reductase, NrdH-redoxin [Lactobacillus casei BL23]
    MRNITLFTRNGCPQCRMTKRYLDTHKIPFTEHNINEEPQYIDYLKQKGFQQVPVLEADGLDSFSGFRPDALKQLAV

    >gi|191638514|ref|YP_001987680.1| methionine sulfoxide reductase B [Lactobacillus casei BL23]
    MSDQFEKESKKDLKKRLSPEAYAVTQEAATERPFTGEYDDFYQDGIYVDIVSGEPLFSSQDKYDAGCGWPSFTKPISKLA
    EHRDQSFGMERVEVRSPSAESHLGHVFTDGPAAKGGLRY
    CINSAALRFIPVADLEKEGYGDYRQLFKSVH

    >gi|191638704|ref|YP_001987870.1| Thioredoxin [Lactobacillus casei BL23]
    MKELGSNAAILNEVKQPGKKMLFFSADWCSDCRFIKPAMPEIEKDFSDYEFIAVDRDKNLEVAQDMGVFGIPSFIAFNDG
    KETGRFVNKDRKTKQQVEDFINGLH

    >gi|191638725|ref|YP_001987891.1| Transcriptional regulator Spx [Lactobacillus casei BL23]
    MVILYTSPSCTSCRKARAWLKENKIPFEERNIFSDPLNVDEIKRLLRMTEDGTEEIISTRSKIFQELGINIDDLSTGTLI
    KLVAKYPGLLRRPIMMDDKRLQVGYNEDEIRRFLPRSVRTMELQQAQLLAGF

    >gi|191638808|ref|YP_001987974.1| Putative glutaredoxin [Lactobacillus casei BL23]
    MAIHFVIYEKPNCESCRLTKRWLAEHGQHFRTTNHRGESNLVDINANDPLKRAWSHQKIVKFREAGYDRFPVVRVRDDAT
    GDVLATWSGFRPEALASWTAINQLG

    >gi|191639121|ref|YP_001988287.1| Glutathione reductase [Lactobacillus casei BL23]
    MSEYDFDVLYLGSGHGAFDGAGPLAASGKKVGVIESDMIGGTCPNYGCNAKITLDTPVVLQRMAERMQGIVSGSITINWS
    ELVAHKQAVIKPLPTNIGSNLKQTGVTIIHGHGKFIDPHSITVAGKTYTAENIVIATGRRPHHLDIPGTELAHDSRAFMD
    LKTLPKRIGILGSGYISMEFATIANAAGAEVSVFMHADKALREFHQPFVKAVMADMTKRGVKFIPSADVQALKQTAQGIA
    IQYGDHQEQQVDWVLDATGRIPNDDQIGLEAAGVTFSQRGIPVDDHLRTNVPNIFASGDVLDKPQPKLTPTATFESYYLY
    QLLSGQTTEPIDYPAIPSTVYTTPRIAKVGVTPEEAADGDYQVVRNHIPDDWYHQTDQETMGDSILIFDRDHHLVGATEF
    SAQAEDAINTLLPAIVFHFSKQQMWQMAHIFPSESAAAWHKIR

    >gi|191639431|ref|YP_001988597.1| Alkyl hydroperoxide reductase, C subunit [Lactobacillus casei BL23]
    MSYIGQHLPAFKLNAYQHGDFHEVSDTDLKGKWAVICFYPADFSFVCPTELGDLQDHYERFQAVGAEVYSASEDTEFVHM
    AWAEASPTIKKIQYPMLADPAGKLATALDVRDEASGQAFRGTFIIDPDGVIQAYAVNNFGIGRNADEILRTLQAAQFVAA
    HGDQVCPANWQPGAKTLTPGADLVGKI

    >gi|191639538|ref|YP_001988704.1| Glutathione reductase [Lactobacillus casei BL23]
    MIVMAYDYGTIVIGGGPGGLAAAYGLAAKQKVLVVENDLWGGTCPNYGCDPKKMLYRGVEVKNAALRMNGFGISGTAKID
    WPSLMAFKRSYTTGVPAGTLNGLTHAGITTLYGHAQLLGEHAVKVGSQNVTGEHIVIATGHTPRYPDIPGANLLKTSRDF
    LDLDQLPTSIAFIGAGYVSVELANIAAAAGADVHIIGHSDRLLRAFPKVATEALKPLLAKTGIHFHPNVELTKITPLGTM
    THLHADNFDLNVDMAITAMGRIANVADLGLANAGIKADTRGIPVDDHLRTAVETIYAIGDVNLKPQPKLTPVASFEGSYV
    AKQILGDQTLITYPAIPNIVFGPTELAKVGVSLETAEAAPDQYTVKHNETTHWYTYNRIQDPDAQVWTIVDKKTGQLAGA
    VVLASLAEDLINTFAAAIDAGEKPSELNKIYAYPSAQSDLQYLF