Lactobacillus casei ATCC 334 uid57985

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116493643|ref|YP_805377.1| copper chaperone [Lactobacillus casei ATCC 334]
    MTKLVYQLDGLTCPSCLQKIEGALGQQAGVKTVKALFNSSKVKAQIDPSVTNADVLKKTITDLGYTVVNVRSQEA

    >gi|116493716|ref|YP_805450.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus casei ATCC 334]
    MQYTRLAMPNHAYFIVADQGKLAFVGSPDAPLSEAADYVSGSLEFNQEEMLPFQNAIDDYLTGKAQTITVPVTYHGTPLQ
    EAVWQYLQTIPYGETRTYAQVAAAVGHSHAFQAVGSAVGKNPVMIAVP
    CHRVLRKDGGLGGFRGGLPMKRDLLALEQGQR
    PIF

    >gi|116493757|ref|YP_805491.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei ATCC 334]
    MKVVVVGCTHAGTAAVRELLMKHPETEVDVFERREDISFLSCGIALYLEGTVGRLEDMFYATPASLEALGPHVHVHLKHD
    VLSIDAADHRILAENLKTGNQQHYQYDKLVMATGSYPVVPPISGVSIPRVLMCKNYDDARRIKESAKDAEHIAIVGGGYI
    GVELAEAYSRNHKQVTLINGVSPLLSHYVDLPLSHEISEALTTRGVELKANTVAKHFDSDDQHVFIQTDKGEIQADLAVV
    CVGFRPMTELLIGQVDMNPDGSIHVNDYMQTSNPDIFAAGDAVAVHFNPTGKDAYAPLATNAVRQGMMAGANLFKPTIKY
    MGTQATSALKLYDHNLGVTGLTLAHAKRNHLSAASVTMTDDFRPPFMPDTVKITMVLVYDTDDRRILGAQFYSQYDIVNA
    ANLISVMIQNRNTIDQLAYVDMLFNPNYDKPWHYLNLLGQLAVTQADNTTA

    >gi|116493829|ref|YP_805563.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus casei ATCC 334]
    MAIEATKDNLKALTAEGTVVVDFWAPWCGPCKVLDPMLTALEQELPALKVVRYNVEKDHTLPSTMGIMSVPTLVIYQQGE
    AREKVTGVYPKDKLKRYFEQKLEA

    >gi|116493853|ref|YP_805587.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei ATCC 334]
    MKILVIGATHAGTFATQQILTEHPDYDVTVYERNHNLSFLSCGIALWVGDHVSDPEKMFYSSPEALAALGANMQMEHDVL
    AIDPVAKTVEVKDLKTGNVTTDTYDKLVYTTGSTPIVPNIPGIHDTDVHL
    CKNWHDAKALKALAPTIKSAIVIGAGYIGA
    ELAEQYALTDKQVTLIDGLPRVLAKNFDANITDRVEKLYTDHGVNLALGEMVTGFTQGTDGEMTVTTDKGSYTADIAVLC
    TGFRPNTELLKDHLETLPNGAVITDAYMQTSDPAIFAAGDTATVHYNPTGKNDYIPLATNAVRQGILVGKNIEKPTEKYL
    GTQSSSAVELFEHAIAASGMTTEGAKARGIEVASVTIEQDYRPDFMLTTTPVLCSLTWDPKTHEVKGGAFFSKHDISQSA
    NVISLAIQTHMTIETLAMVDMLFQPNFDQPINWVNAVAMAAVAKAQEMEKTPVA

    >gi|116493961|ref|YP_805695.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus casei ATCC 334]
    MDKPKIIVVGASHGGHQSVLELLHRYPDADITMFEAGDFVSFMSCGMELFLENQVTDVNDVRNFRPDDLIKRGAHVLNNH
    EVTAINADVKSVTVRDTKNGTTQDYPYDKLILSSGVRPNSLPVPGNDLKNVFLMRGYDWATNIKAKLEDPAVKHVTIIGA
    GYIGIEAAEASRKAGKQVTLLDMIDRPLGTYLDPEMTDILAKELTDKGVELKLGVKIEAFTGDEAVSAVKTDAGDVKTDL
    VIQAAGIKPATEWLKGTVNLDKRGFINTDPYLRTNLPDVYAIGDATLVYSIPAQQKVPIALATVARREARYLAENIFAEN
    PARPFKGVVGSSALSVFDYHFAASGLNTFTAKRADVNVHTAFYTDSLRPDYVPEANGNPQVCVNLVFDPQTHRLLGGAVL
    STYDVTAQGNVLALAVQQQLSLEDLAEADFFFQPGFDRQWSLLNLAAQHALGEPRF

    >gi|116493987|ref|YP_805721.1| redox protein, regulator of disulfide bond formation [Lactobacillus casei ATCC 334]
    MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRV
    KVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENR
    CPVSKLLKNSGNYTIETVTDFKD

    >gi|116494078|ref|YP_805812.1| hypothetical protein LSEI_0520 [Lactobacillus casei ATCC 334]
    MNSTNAMKRVGYGYVSHTEQAIIEKLSREEKHMQAIIYTKPHCQKCRRTVFKLSRVMPVQTITADADDYERFRKLGYRSM
    PVVTIYEADGTHDEWCDLRVDKIKQYTEGNI

    >gi|116494098|ref|YP_805832.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus casei ATCC 334]
    MKHPFRHFLINAVIGIVIATVSLSALYVYAPKKMIDVATPVTINAQKKDQYILYYSPTCSVCQQVYRTYFWRSVTGKLKF
    ASVANEQNREAAAALGITKVPTLVHYKKGKVVTQYTGYQEQQIDKVLAGGKAGEH

    >gi|116494187|ref|YP_805921.1| redox protein, regulator of disulfide bond formation [Lactobacillus casei ATCC 334]
    MAERSLYHTYVRNENGLVGESYVEGNQGLALGVSSSLIDAPGTNPEQFIAFALSTCFNATIRIVQHREGTAEDSQLRTRV
    DITRDKIGYKFIVDAQILMPSHTREEAQKIVTQALDE
    CPVAKLLKENENVSFRIVDDFTDEPTLGE

    >gi|116494287|ref|YP_806021.1| peroxiredoxin [Lactobacillus casei ATCC 334]
    MEITRHGEALTTNGTPIELGEQLPTFTVTNAQAKPVTTQDLSKRLTLISVVPDINTRVCSISTKHFNEDMDAFDHTDFYT
    ISTNTPQEQQSWCAAEGVKKMQLLSDQNGDFGKAMGLFVADNHTDARSVWIVDGTGTVKYRELITEQTHEPDYTSALAYL
    EAHQH

    >gi|116494336|ref|YP_806070.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus casei ATCC 334]
    MVQAVTDSNYKTETDTGVTLTDFWATWCGPCRMQSPVIDKLAESRDDVKFVKMDVDANPETPKSFGIMAIPTLVIKKDGE
    VVEKLVGYQTKDQLESTLNKYTA

    >gi|116494401|ref|YP_806135.1| glutathione peroxidase [Lactobacillus casei ATCC 334]
    MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLGFPSDQFKQELADGHAAAEAC
    RLKYGVSFPMHALIKVNGKEAAPLFQYLKTQAPGELGKSIKWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG

    >gi|116494455|ref|YP_806189.1| thioredoxin reductase [Lactobacillus casei ATCC 334]
    MAKKYDVIVIGAGPGGMTAALYASRANLSVLMLDRGVYGGQMNNTAEVENYPGFKSILGPDLGQKMYDGATQFGAEYAYG
    NVVSVQNRGAVKLVKTDEDEYEAKAIVIATGAEHKKLGVPGEEAYSGRGVSY
    CAVCDGAFFKDRELAVIGGGDSAIEEGL
    YLTQMAKKVTVIHRRDQLRAQQIIQKRAFANDKMHFVWNAQVQEIQGDDMKVTGVKYRDKETGEEHVLPVAGVFIYVGIM
    PMTEAFQDLGVLDEHGWIPTDEHMRTKVPGVFAIGDVRAKDLRQITTAVGEGGTAGQGVFNYIQSLNDTNIEIKA

    >gi|116494696|ref|YP_806430.1| peptide methionine sulfoxide reductase [Lactobacillus casei ATCC 334]
    MERDVFLAKVTNLMLAPGTRAFEREQLRQAKHLVEAGRPVAEGWAQLESSLRPLAMRDNLTPDVADFYRAETGDPAGAVQ
    TDLSAHFDRDVPFQERAIFAGG
    CFWCMVEPFVDLPGITAVTSGYTGGHSAHPTYEQVIGGYTGHVEAVEIIFDTRKMSYA
    ALVALYFQLTDPTDALGQFQDRGSQYRPVIFVKDDTQRQIAEAAKAELAASGRYLRPIITAIEPVATFWPAENYHQDFYK
    KNPKRYQMVERTRRQFLQFQRAQGNLRVMLKRRKKA

    >gi|116494797|ref|YP_806531.1| dihydrolipoamide dehydrogenase [Lactobacillus casei ATCC 334]
    MVVGDFAIDLDTVVIGSGPGGYVAAIRAAEMGQKVTVIESTFIGGVCLNVGCIPSKALINAGHRYQDALEASTFGINAKG
    ADLDFTKTQEWKQNKVVHTLTSGVSMLFKKHKIDTIMGTAFLKDDHSLRVMQKDSAQTYTFKNLIIATGSRPIEIKGFKF
    GKRILDSTGGLNLPEVPKEFVVIGGGYIGSELASAYANLGAHVTILEGTSSILPNFEKDMVQLVLNSFKKRGVTVITNAM
    AKEAEDTGKGVKVTYTADGKEQTIAADYVMVTVGRRPNTDDLGLDIVGVETTDRGLIKVDAQGRTNKPNIYAIGDIVPGA
    ALAHKASYEGKVAAEAISGKASAVDYKAMPAVCFTDPELATTGMTVAEAKDKGIKAKASKFPFAANGRALSLAQTEGFVR
    LVTNENGTVIGGQVAGAGASDLISELTVAVEGGLNVEDLALTIHPHPTLSEVIMDDAEVALGLPINI

    >gi|116494932|ref|YP_806666.1| acetoin/pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Lactobacillus casei ATCC 334]
    MTMNTDLVVLGGGPGGYVAAIRAAQLGMQVVLVEKAKVGGICLHKGCIPTKSLLHSGETLRLMQSAATFGGIIEGKVGID
    FAKIQARKATVVDQLYRGVQGLMKKNKITVLNGTGAVLGPSIFSPVSGTVSVTFDDKSKEDVMIVPKHVIIATGSSPKTL
    PSLPIDEKMILTSNGMLELTALPKKVAIIGGGVIGVEWASLLNDFGVDVTIVEFLDQLVINESQTIARELQKQLENRGIH
    IQLGAKVEQATIKNKQVALTIAEQSDPLIVDKVMVAIGRQPNVEGIGLQNTSIKYSAKGITHNAFYQTTEDHIYAIGDVI
    DTLQLAHVAMKEGIIAVEHMAGLPVAPLNYNDVPRCTYTDPEIASVGYTSSNYPQDRDVKIGRFNFNANAKAIILGDTAG
    FVEVLRDVITDDIIGVSIIGAHATDMIAEMSDAMYLDASATEIGDAVHPHPSLSEAIQEATLDTHKIAIHK

    >gi|116494953|ref|YP_806687.1| glutaredoxin-like protein [Lactobacillus casei ATCC 334]
    MRNITLFTRNGCPQCRMTKRYLDTHKIPFTEHNINEEPQYIDYLKQKGFQQVPVLEADGLDSFSGFRPDALKQLAV

    >gi|116495008|ref|YP_806742.1| methionine sulfoxide reductase B [Lactobacillus casei ATCC 334]
    MSDQFEKESKKDLKKRLSPEAYAVTQEAATERPFTGEYDDFYQDGIYVDIVSGEPLFSSQDKYDAGCGWPSFTKPISKLA
    EHRDQSFGMERVEVRSPSAESHLGHVFTDGPAAKGGLRY
    CINSAALRFIPVADLEKEGYGDYRQLFKSVH

    >gi|116495195|ref|YP_806929.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus casei ATCC 334]
    MKELGSNAAILNEVKQPGKKMLFFSADWCSDCRFIKPAMPEIEKDFSDYEFIAVDRDKNLEVAQDMGVFGIPSFIAFNDG
    KETGRFVNKDRKTKQQVEDFINGLH

    >gi|116495215|ref|YP_806949.1| arsenate reductase [Lactobacillus casei ATCC 334]
    MVILYTSPSCTSCRKARAWLKENKIPFEERNIFSDPLNVDEIKRLLRMTEDGTEEIISTRSKIFQELGINIDDLSTGTLI
    KLVAKYPGLLRRPIMMDDKRLQVGYNEDEIRRFLPRSVRTMELQQAQLLAGF

    >gi|116495295|ref|YP_807029.1| glutaredoxin-like protein [Lactobacillus casei ATCC 334]
    MAIHFVIYEKPNCESCRLTKRWLAEHGQHFRTTNHRGESNLVDINANDPLKRAWSHQKIVKFREAGYDRFPVVRVRDDAT
    GDVLATWGGFRPEALASWTAINQLG

    >gi|116495642|ref|YP_807376.1| glutathione reductase [Lactobacillus casei ATCC 334]
    MSEYDFDVLYLGSGHGAFDGAGPLAASGKKVGVIESDMIGGTCPNYGCNAKITLDTPVVLQRMAERMQGIVSGSITINWS
    ELVAHKQAVIKPLPTNIGSNLKQTGVTIIHGHGKFIDPHSITVAGKTYTAENIVIATGRRPHHLDIPGTELAHDSRAFMD
    LKTLPKRIGILGSGYISMEFATIANAAGAEVSVFMHADKALREFHQPFVKAVMADMTKRGVKFIPSADVQALKRTAQGIA
    IQCGDHQEQTVDWVLDATGRIPNDDQIGLEAAGVTFSQRGIPVDDHLRTNVPNIFASGDVLDKPQPKLTPTATFESYYLY
    QLLSGQTTDPIDYPAIPSTVYTTPRIAKVGVTPEEAADGDYQVVRNHIPDDWYHQTDQETMGDSILIFDRDHHLVGATEF
    SAQAEDAINTLLPAIVFHFSKQQMWKMAHIFPSESAAAWHKIR

    >gi|116495950|ref|YP_807684.1| peroxiredoxin [Lactobacillus casei ATCC 334]
    MSYIGQHLPAFKLNAYQHGDFHEVSDTDLKGKWAVICFYPADFSFVCPTELGDLQDHYERFQAVGAEVYSASEDTEFVHM
    AWAEASPTIKKIQYPMLADPAGKLATALDVRDEASGQAFRGTFIIDPDGVIQAYAVNNFGIGRNADEILRTLQAAQFVAA
    HGDQVCPANWQPGAKTLTPGADLVGKI

    >gi|116496055|ref|YP_807789.1| glutathione reductase [Lactobacillus casei ATCC 334]
    MAYDYGTIVIGGGPGGLAAAYGLAAKQKVLVVENDLWGGTCPNYGCDPKKMLYRGVEVKNAALRMNGFGISGTAKVDWPS
    LMAFKRSYTTGVPAGTLNGLTHAGITTLYGHAQLLGEHAVKVGSQNVTGEHIVIATGHTPRYPDIPGANLLKTSRDFLDL
    DQLPTSIAFIGAGYVSVELANIAAAAGADVHIIGHSDRLLRAFPKVATEALKPLLAKTGIHFHPNVELTKITPLGTMTHL
    HADNFDLNVDMAITAMGRIANVADLGLANAGIKADTRGIPVDDHLRTAVETIYAIGDVNLKPQPKLTPVAGFEGSYVAEQ
    ILGDQTPITYPAIPNIVFGPTELAKVGVSLETAEAAPDQYTVKHNETTHWYTYNRIQDPDAQVWTIVDKKTGRLAGAVVL
    ASLAEDLINTCAAAIDAGEKPSDLNKIYAYPSAQSDLQYLF