Lactobacillus brevis ATCC 367 uid57989

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116332761|ref|YP_794288.1| peroxiredoxin [Lactobacillus brevis ATCC 367]
    MNYIGSVLPDFQVNAFQNGEVNSLTRSDLMGHWSILFFYPADFSFVCPTELGDLADHYDAFQQADTEIYSISEDTEFVHQ
    AWHEQSAEVGKVTYPMIADPAGVLARHYDVLNEQLGQAYRGVFILDPQGTVRSYTVNDMGIGRNAGEILRTLQAAQFVAE
    HGDRVCPANWHAGEQTLKPGTDLVGKI

    >gi|116332991|ref|YP_794518.1| methylated DNA-protein cysteine methyltransferase [Lactobacillus brevis ATCC 367]
    MLQKQLTTPLGPVTVMSDGLSLMGLWFTDQKYYGSTLPKLTVISDRPIFTRVQMWLDAYFAGDQPAIDFPVRPQGTPFRQ
    AVWQQLREIPYGTVLTYGQLATQLSEQLGHFVGGQAIGGAVGHNPISLVIP
    CHRVVASDGALTGYAGGLDRKRALLQLEG
    SLAAGYEQVPLD

    >gi|116333003|ref|YP_794530.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus brevis ATCC 367]
    MKVIIVGSTHAGTNAALQILRDHPETDVTIYERHDNVSFLSCGISLFLDGQVKHLEDMFYSSPEQLEAAGAKVLTRRNVI
    KIDSAEKTVDVVNMENGDVSTDTYDKLIMATGSTVTVPPIFGIDEDKVML
    CKNYEQAVAINEAAKGNKRIAIIGAGYIGT
    ELAESYARTGHDVQLFQSRDIILNHYVDKSLSDRIVDMLKKQGVQVSLNHRVTSFTGNDNGELVIETNDGDYVADLAVVC
    TGFVPNTELLRGQVEMDRHGAIIINDYVQTSNPDIFACGDASVVNFNPTGKPAYTPLATNAVRQGMLAGINVFGNIQRYM
    GTQATSAMNIFGHTLASTGLTIDHAKEAGMDADQVTFEGTWRPTYMPTTDDLTINLVYNRQNRRILGAQLFSEHEVAQSA
    NAISIAIQNRNTIDDLAFVDMLFNPNFDDPFNYLNLVAQQAVEKEVKRGNNHPRLTAGIDPDSEATETD

    >gi|116333004|ref|YP_794531.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus brevis ATCC 367]
    MQAITSKEFEHIGDDTAVTVVDFWADWCGPCKMQTPVLEDLDQAYGDQVKFASLDVDQNQELAQSLGIMSIPSLVIFKNG
    MPTEKVVGFHPKAALKKYLDEKLTEVTA

    >gi|116333096|ref|YP_794623.1| glutathione reductase [Lactobacillus brevis ATCC 367]
    MADFDCIVIGGGPGGLAAAYGLHERGLKVAVVEKDLWGGTCPNRGCDPKKILMAAVEAQGRSEALQGHGLTGVPQIDWSS
    LMATKRAYTEKIPTGTQGGLQSAGIANYHGEASFEADGHLTVGNTQLSATNFIIATGQAPRIPNITGQEWLRTSNDFLDL
    DTLPADITLMGAGYVGIELAAIANAAGSQVHLIHHSDRPLRGFDGELVTALLKRLMVDGIDVQLDTDITAVTPADDQYQV
    TTASGKTWTTGLVFATAGRLPVTAGLHLERVNVTTTAHGIQVNDHLQTTNPRVFALGDVVDRPQPKLTPVAGFEGRYLTQ
    TLAKKDQPAITYPVIPAVVYGKTQLAQLGVTPATATQQPETYAVSDLDLTSWYSYRRIQDADARIKVVTERSTQRIVGAT
    MLSSEAEQLINYLDFVIQNQLTPTDIDQAILAYPTLASDLTYFG

    >gi|116333246|ref|YP_794773.1| glutaredoxin-like protein [Lactobacillus brevis ATCC 367]
    MKVTIYSKNNCMQCKMTKRFLSEHNVEFEERNINQHPEYVSYLKDKGFQAVPVVEAPGVPAFYGFRPDQLTQIAG

    >gi|116333294|ref|YP_794821.1| thioredoxin reductase [Lactobacillus brevis ATCC 367]
    MKSYDVIVIGAGPGGMTGALYASRANLSVLMLDRGIYGGQMNNTAAIENYPGFKSVLGPDLAKDMYEGSTQFGAEYAYGS
    VTAIEDHGDHKIVKTDDGDYETKAVIVATGSEYKKLGVPGEDKFGGRGVSY
    CAVCDGAFFKNREVVVIGGGDSAVEEGLY
    LAGLASKVTIIHRRDQLRAQKILQDRAFANDKIEFVWNTNVTEILGDDMKVTGVATKNNQTGETGEIAASGVFIYVGTLP
    MTDAFTDLGITDDAGWIKTNDHMATAVPGIFAIGDVRQKDLRQITTAVGDGGIAGQAVFSYLEDLKSQAASAQ

    >gi|116333340|ref|YP_794867.1| copper chaperone [Lactobacillus brevis ATCC 367]
    MSKVTMKLDDLTCPSCMTKIEGALSKKDGVENVKVLFNASKIKAEFNTDKVSAESLEAAVTDLGYTVKSAKVKDL

    >gi|116333356|ref|YP_794883.1| redox protein, regulator of disulfide bond formation [Lactobacillus brevis ATCC 367]
    MAIDREKFPPLYRTVAINDDGLESHSYIPGGLDVLTSSPSNDQPGANPEQFVGLALSTCLNATLEAIEQRRDLPHTSQVH
    TIVEMARDRRGLQFYVTAEIKLPGVDLDTAKAMVDLAERR
    CPVAKLMSGSDNVQVKLVQEFSPAPPIVH

    >gi|116333384|ref|YP_794911.1| peptide methionine sulfoxide reductase [Lactobacillus brevis ATCC 367]
    MSEIETATFAGGCFWCMVRPFDTLPGIKRVLSGYTGGTVTNPTYEQVKSQTTGHTEAVKIWFDPAVVSYQQLVELYWQQT
    DPTDAAGQFQDRGSNYRPVIFVNSRQQAEIAVASRAALQAREQFDQPIVTQIQVVQPFFVAEERHQQFYRKNPERFDQEE
    AGGRATFIARHWQEN

    >gi|116333456|ref|YP_794983.1| peptide methionine sulfoxide reductase domain-containing protein [Lactobacillus brevis ATCC 367]
    MNKHESQEDLKQRLTAEEYAVTQKAATEPAFTGKYDQFDQPGIYVDVVSGQPLFSSTDKYDAGCGWPSFTKPIDAENVQE
    NTDHSFGMIRQEVLSTDAHSHLGHVFNDGPTEAGGLRY
    CINSAALKFIPASELETQGYHGFDALFKD

    >gi|116333457|ref|YP_794984.1| peptide methionine sulfoxide reductase [Lactobacillus brevis ATCC 367]
    MSEFETAIFAGGCFWCMVQPFDTQPGIQSVVSGYTGGHTVNPTYAEVASHTTGHTEAVKITFDPKVISYAQLVEIYWHQT
    DPTDASGQFQDRGDSYRPVIFVNNPEQRRVAEASKAALAANGQFDAPIVTTIEEAQPFYPAEEEHQDFYRKNPFRYQIEE
    MGGRQDFINQHWRDKID

    >gi|116333687|ref|YP_795214.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus brevis ATCC 367]
    MEQLPKMSATELTDVVKSGKTMLFFSATWCPDCAFIKPAMPEIEAEYPDFKFVAVDRDENIDLAAELNVFGIPSFIAYAD
    GQEIGRLVNKDRKTKAEVEEFINSLTTNAN

    >gi|116333780|ref|YP_795307.1| arsenate reductase [Lactobacillus brevis ATCC 367]
    MTVTLYTSPSCTSCRKARLWFEEHGIAYREQNIFSEPLTVNDIKSILRLTEDGTEEIVSKRSRAYQELTVDLDDLPLRDL
    YALIQEHPGILRRPIMVDEKRLQVGFNEEEIRRFLPRKVRALELQRAQRLVNGVN

    >gi|116333826|ref|YP_795353.1| Thiol-disulfide isomerase and thioredoxin [Lactobacillus brevis ATCC 367]
    MATVVETTDKTFEADTAKGVTLTDFWATWCGPCRMQSPVVEQLADEMGDQVTFNKMDVDANPNTPQSFGIMSIPTLLVKK
    DGTVVDSIVGYHSKDQLKKILDQYL

    >gi|116333863|ref|YP_795390.1| peroxiredoxin [Lactobacillus brevis ATCC 367]
    MEVSVRGDKMSLSGDLPEVGTQLPKFKLFDQNDTKVKTANLIGKVALISVVPDLETPVCTMQTRKFIQQADHYPAAKFYT
    VSNNTIAQQTGWCAAEGVENIDMLSDTELSFGYEMGLYIPNAGNLARSIWIIDDTGKIVYRQVVDEQTDEPNYLAAIEAL
    EKLVPRVDV

    >gi|116334009|ref|YP_795536.1| dihydrolipoamide dehydrogenase [Lactobacillus brevis ATCC 367]
    MADVEKKDTVIIGAGPGGYVAAIRASELGQKVTLIEKSDTLGGVCLNVGCVPSKALIQAGHRLEQAKDGSTYGISTDSAT
    IDFKKTQEWKQKKVVDRMTSGVKMLMKKHHVDVVSGEAVFLSDTQLRVMPTGEKQFMSTDTGQTFEFNNIIIASGSHPIQ
    IPGFKFDGRVVDSTGGLNLPEIPKEFVVIGGGYVGTELAGAYASLGAHVTILEGSPSILPNFEKDMVSVVLKKLKKKGVD
    VITNAMAKSSSQDDQSVSVTYAVDGKESTIKADYCMVTVGRRPNTDDLGLEYTKVELNDHGQIKVDNQGRTASEHIWAVG
    DVVPGAALAHKAFAEAKTAAGAIAGKKTANDWLSVPAVCFSDPEIATVGYSESAAKDKGIKVKTAKFPFAGNARAVSLDS
    PDGFVRFIYTDDDNQNIVGAEAVGPEASTMAGELSVIVNDGLNVEDVALTIHPHPTLNEPIQETADIALGFPTHI

    >gi|116334141|ref|YP_795668.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus brevis ATCC 367]
    MKVTVVGCTHAGTFAIKQILAEHPDAEVTVYERNDVISFLSCGIALYLGGKVADPQGLFYSSPEELQKLGANVQMNHNVL
    AIDPDQKTVTVEDLTNHAQTTESYDKLVMTSGSWPIVPKIPGIDSDRVKLCKNWAHAQALIEDAKEAKRITVIGAGYIGA
    ELAEAYSTTGHDVTLIDAMARVMPKYFDADFTDVIEQDYRDHGVQLALGETVESFTDSATGLTIKTDKNSYETDLAILCI
    GFRPNTDLLKGKVDMAPNGAIITDDYMRSSNPDIFAAGDSAAVHYNPTHQNAYIPLATNAVRQGILVGKNLVKPTVKYMG
    TQSSSGLALYDRTIVSTGLTLAAAKQQGLNAEQVIVEDNYRPEFMPSTEPVLMSLVFDPDTHRILGGALMSKYDVSQSAN
    TLSVCIQNENTIDDLAMVDMLFQPNFDRPFNYLNILAQAAQAKVAQSVNA

    >gi|116334565|ref|YP_796092.1| glutathione peroxidase [Lactobacillus brevis ATCC 367]
    MTMIYDFQETEMSGQPLNLADYRGKVVLIVNTASKCGLAPQLVGLEDLYQRYHSQGLEVLGLPSNQFHQELESDEATSDF
    CQVHYGVTFPMTKKIQVNGADEDPLFTYLKKTAGHGRIKWNFTKFLIGRDGQLIARYAPTTKPEKIEPAIVTALQPD

    >gi|116334612|ref|YP_796139.1| glutathione reductase [Lactobacillus brevis ATCC 367]
    MSVENYDYDVLYLGSGHGTFDGAIPLAAKGVKVAVVEGGLIGGTCPNRGCNAKITLDAPVALQRQLAALNPVITGNTTIN
    WPANMAHKHEVIDGLPNFIGGLLKDNGVEVITGYGKLTAAHSVQVGDQTYTADKIVLATGLHSHRLAIPGSELAHDSEDF
    LNLTSLPARMTVIGGGYIALELATIANAAGSDVTILLRGQQALRQFHQPFVETVLSDLTDRGVQILRETQVTALKQADNA
    LQVVTDTQGTLVTDWVLDATGRDPNTQNLGLEDVGVAYTDHGITVNDHLQTSVPNIYASGDVIDKEQPKLTPTAIFESMY
    LSQTFAGETTEPIDYPAIPTVVFTSPRLAQVGVSVAQAQKDGATVETNHVPNDWYRQVGKESQGDNALIFDAEHHLIGAT
    EVSEQAADVINTLLPAIEFQYGPAEIGRLVHLFPTIGASAWGQL

    >gi|116334886|ref|YP_796411.1| NAD(FAD)-dependent dehydrogenase [Lactobacillus brevis ATCC 367]
    MSKTKVIVVGASHGGHQSVLELTHKYSNLDIKLFEAGDFISFMSCGMELYLENSVTSINDVRNFKPADLEKFGTEVYANH
    EVTKINPENKQVTVKDLRSGKIQSYDYDKLILSSGVTPNDLPVPGHELKNVYSMRGKDWAEKIKAKLSDPDVKNITVIGA
    GYIGVEAAEASIKAGKNVTLIDMINRPLGNYLDTELTDILSKELTSKGVQVVTGSKIECYEGTESVSAVKTNDAEYPSDL
    IIQAVGVKPNTDWLKGTVELDKRGWIKTDKYLRTNLPDVYAIGDAVLAYSIPAQRNMPIALATVARREARYVVEHIFENT
    PSMPFSGVVGSSALSVFDYHFATSGLNMTTAQKADIKINTSFYKDTLRPAYVPMEKGNTEVYVELDYNPNTHQLLGGAVL
    STYDITAQGNVISLAIQQGLKLEDLAEADFFFQPGFDRQWSLLNLAAQRALGELEFTK