Lactobacillus acidophilus NCFM uid57685

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|58336594|ref|YP_193179.1| S-methyltransferase [Lactobacillus acidophilus NCFM]
    MSELSKLTIKVPIGLLEITATDEAIVGVKPANHGENVEANDLAQKCKTELEEYFAGKRKNFDLPLADEGTDFQKQVWEQL
    QLIPYGQTRTYGEIAKMMGKPKASRAIGMANHNNPILILVP
    CHRVIGADGSLTGYAAGIEAKKYLLEFEKKNK

    >gi|58336759|ref|YP_193344.1| thioredoxin reductase [Lactobacillus acidophilus NCFM]
    MVEAINDQNFEEETNSGVALIDFWATWCGPCKMQSPVIEQLAEERQDVKFYKMDVDQNQDTAKNLGIMAIPTLIIKKDGN
    IVDRITGYTPKEKLNQILDQYAN

    >gi|58336869|ref|YP_193454.1| putative heavy-metal-transporting ATPase [Lactobacillus acidophilus NCFM]
    MEKVMMKLSGMTCPSCLSKIEKAVGSLDGTDQIKVLFNAGKLKFTLDPDKTKTVDVKTAIEKMGYEVQEIKEKELN

    >gi|58336966|ref|YP_193551.1| putative arsenate reductase [Lactobacillus acidophilus NCFM]
    MVDLYVSPSCTSCRKARAWLEKHNIPFKERNIFSEPLTKEELLKILRMTENGTEEIISTRSRAFQQLKINLDDLSIDQLL
    DLVEKNPSLLRRPIIMDDRRLQVGYNEDEIRRFLPRKVRRLELAEAQKIADL

    >gi|58337001|ref|YP_193586.1| thioredoxin reductase [Lactobacillus acidophilus NCFM]
    MADKYDVIVIGAGPGGMTAALYATRANLNVLVLDRGPYGGQMNNTDAIDNYPGFTEVKGPELSQKMYDTLMKFEPDYKYG
    NVQSVELDGDEKVIKTDDEEYRAPVLIIATGADHRHLNVPGEEEYSGRGVSY
    CAVCDAAFFKDEDVVVVGGGDSAIEEGI
    YLSQMAKSVTVIHRRDQLRAQPTLQKRAFANEKMKFIWNAQTEEILGDGNRVTGVKYLDKENGETKEVSAAGVFIYVGVL
    PQTEPFKKLGILNEQGWIPTNEHMETKVSGIFALGDVRDKDLRQIANAVGEGSVAGQAAYNYFQDLKN

    >gi|58337339|ref|YP_193924.1| thiol peroxidase Tpx [Lactobacillus acidophilus NCFM]
    MKITFKGKEVKLVGTPPAVREEMPNFTVLDKNNQEFTKSDLLGKFSLISVVPNINTPVCSIQTKTFNKAMDKFPEINFLT
    ISTNTIEDQQTWCAAEDVKNMKLMSDKNLSFGKATGLLIPEFGILARSVWVLDPNCKILYRELVDEITHEPNYDAVLNEL
    KQLH

    >gi|58337397|ref|YP_193982.1| glutathione reductase [Lactobacillus acidophilus NCFM]
    MKKYDYIILGSGPVAIHLLAKLERTTNKVLLIEKGLWGGTCPNTGCQPKIFMEGTVRPVLNSYYLAGKGIKEAAKIDWPT
    LVARKKKIWTAFHKNERKSMTSEHTDTVQGKGVITGPHTVKVGDQEYEGKNIVIGTGLAPRDLDVPGNEYAITNNEFFDL
    DKLPKRAIVIGGGYVAMELATILQAAGAEVTILQHSDRLLRPFDQEMVGTLKRIMEDRGIKFHLNAPVKEIAKDGDQYTV
    TTENGDTFDTDLVINAAGRKPNVEGIGLEDVGIEFDPNKGIKVNEHMQTNIPSIFAAGDVADNGQPSLTPVAWVDAYHII
    NFVENGITDPIQYPPVATNAFTYPEIAQVGICEDEMEEGDYIKTLDLSDMFFSMGEGDSHAKLKVILNKNGEVRGASELS
    IHAAEDINNFVPLVGRKDPKKFVEENLTFAFPTPANNLDTLFR

    >gi|58337490|ref|YP_194075.1| peptide methionine sulfoxide reductase [Lactobacillus acidophilus NCFM]
    MSENNKHIKATDIKENPKYDTAIFAGGCFWCMVEPFDNITGVEEIISGYTGGHTINPTYADVCTGKTGHTEAVKITYDPG
    KISYNQLLNYYWQVTDPTDAMGQFQDRGDNYRPVIFYNSQFQKEAAEKSKQELANSGKFDKPIVTSIEKAMPFYPAEDYH
    QDFYKKDPERYALEESGGRSDFIKKHWSK

    >gi|58337501|ref|YP_194086.1| pyridine mercuric reductase [Lactobacillus acidophilus NCFM]
    MDTKEIKNIIIGFGKGGKTLAKFLASKNEEVLVIEKSNQMYGGTCINIACLPSKRLIIEAANGIEFTDAINSKNEMTSFL
    RNANYHMLADEKTVTVLDGTAKFLSDHEIEVTKNDGTKEKYSGKRIFINTGAIPNYAPIPGLIESNKVINSTEAMDQTEM
    PKKLTIIGSGYIGLEFASMFANYGTKVTVLDNHRDFLPREDNDISEMIKQDLENTGIKFELGVKINRVEDDTVFYEKDGQ
    NLSIKSDRILAATGRKPNTQNLGLENTNIELTDNGAIKVNDHLMTTAQNVWAIGDVKGGPQFTYISLDDYRIIKDQLFGD
    GKRVISDRINIPYSVFITPALSQVGLNEKQAKKQEINYELKKLPVAAIPKARVAKDTRGLFKALVDPTTNQILGATLYGI
    ESYELINQISMAMKAKIPANILRDQIYTHPTMSEAFNDLFK

    >gi|58337629|ref|YP_194214.1| arsenate reductase [Lactobacillus acidophilus NCFM]
    MIKFYGYSRCSTSRKARKWMDEHNIKYEFQDLVETPPKKEDLVKWLNKYQDRGLRYFFNTSGQHYRQQKLKDQIPTMTID
    EAAELMSQDGKLIKRPLVVDDNHLTCGFKEDIFEQTWLA

    >gi|58337645|ref|YP_194230.1| methionine sulfoxide reductase B [Lactobacillus acidophilus NCFM]
    MVLDESKKKQALKKLTQEEYDVTQNAATEYPFTGKYDNFYEKGIYVDVVSGEPLFSSQDKYDAGCGWPSFTKPIEKLQYH
    RDQSHGMERTEVVSPEAQSHLGHVFTDGPVDRGGLRY
    CINSAALKFIPYDQLNEAGYGEYKKLFK

    >gi|58337672|ref|YP_194257.1| peroxidase (Npx) [Lactobacillus acidophilus NCFM]
    MDKRKVIIVGASHGGHESAIELLDKYDDVDVTIYEAGDFISFMSCGMQLFLENKVTAEDDVRNFAPEDIEKKGGHVYANH
    EVTAVHPDKKTVTVKDLTNDSEEEVSYDKLILSSGVTPKVLPVPGSDLKNIYLMRGRDWASKLKAATTDPAIKNVAIIGA
    GYIGTEASEVFAKAGKHVTLMDMIDRPLGTYLNPELLDILEPTFKDHMDLKMGVKIEGFNGTDKVESVETDNGDVSADLV
    VVSAGVSPNTDWLKGTVDLDQRGWIKTDPYLRTNVKDVYAIGDAILPYSIPAGKPMPIALATTARREAQYLVDHLFEAKP
    DQVFKGVIGASALSVFDYHFATAGLNQFSAEKNDIPYGTSFYEDSMRPAYIPEKDNPKVYVSLTFNPYNHQILGGAVLSK
    YDVTAQGNVLALAISHKMTLEDLAEQDFFFQPGFDRQWSLLNLAAQHALGLARF

    >gi|58337699|ref|YP_194284.1| hypothetical protein LBA1428 [Lactobacillus acidophilus NCFM]
    MSDYLVKSQLENKEWQISNHVRDHNFICDANDKKYDAGPNPVEYLCGSVNSCIVMSAGMITKAHQLDVKNFNVKNYAKTE
    KMGYGKSVVTEMRIEVSFDSEMSKEEKEEFLAHVLHVSTIYQTIKEAIKIYVELT

    >gi|58337844|ref|YP_194429.1| thioredoxin [Lactobacillus acidophilus NCFM]
    MEKIKELSEDKLQEITKSGRTVLEFSAEWCPDCRFLDPFLPEIEKDFSDAKFYQIDRDGSVDVAKKLMIMGIPSFVAYQD
    GKEIGRLVNKDRKTKDEVENFLRSLD

    >gi|58338044|ref|YP_194629.1| hypothetical protein LBA1793 [Lactobacillus acidophilus NCFM]
    MNKKNVSMLMLSPAILLMMNSTIVHADKGSTSHEISSKVVSKTKNDDKNVPESEQETSSNNEIDQSQDKQEKEEQAIPED
    QNDQSQNTNNQDPNDASEEDDEDEVSVEDYENNVKDFHRVKMQEVKDLLAEKNNQEHLMYIGRPT
    CYYCRQFSPDLKDFN
    EIVKGKLLYFNIDDEEGAHDYAFKVIGIPGTPTTMRFMNGKLISAWIGGEKTGQELHDFLYSDTANKLVEQVVIKNQSND
    TATQADNDVVASESDKTPEVTVEENNQAQSNNDVAITNFAENSVFENAKNVASSTADLTQVATGDQDDVAPKAETKNKTV
    KKPIKHKIVANKVKKQAKLHKTNIIIPMSAKKREDVKENNQYDTVKVHGTSPNAIKDKQARITMLKELENDTSDTISTVS
    LPSTGEKKNIWIQLMGMISVLVSVVLGISLRKKTKEEK

    >gi|58338141|ref|YP_194726.1| protein-disulfide isomerase [Lactobacillus acidophilus NCFM]
    MEIKYWSDIACPFCYIGSTRMKKAMKEVGIYDDTKLELKAFQLNPMEAKTAKSGEYINHFTGGKKELENRARQQMAYITE
    MAKGEGLEFHLDKVVPTNTMDAHRLIKLVEAKYDRDLTEKLIARLYKVYFTDGESIADLDVLTKAAVEVGMKEDEVKKLL
    NSSKYQREVVTDEYEAEQSGIHAAPFFVINNKYGISGAQPYEVFVNALRKVKEEEEK

    >gi|58338142|ref|YP_194727.1| thioredoxin reductase [Lactobacillus acidophilus NCFM]
    MKKYDVAIIGAGPGGMAAALYAARANLTVAMIDRGVYGGQMNNTAEVENYPGFPSILGPELGEKMYQNTVKQGVNFVYGD
    VQGIEVKDDKRIVKLGSEDSDIETKAVIIGTGSSNRKLGVPGEDEYSGKGVSY
    CAVCDGAFFKNENVVVVGGGDSAVSEG
    LYLANVTDNVNVIHRRDQLRAEQVLQKRAFKNPKMDFTWDSEVKEIIGDENKMTGVKVHNKKTGKDETIDANGAFIYIGN
    IPNSEPFRDLNITDKDGWILTNDQMETEVPGIFAIGDVRKKKLRQIITAVNDGGIAGQNAYEYIQKLTEN

    >gi|58338143|ref|YP_194728.1| putative transcriptional regulator [Lactobacillus acidophilus NCFM]
    MKNMSEVNEFRNEAYDQVVKIGKTLGNVSRLKILDNLVQSKKSVEELARAVGLSIGTTSKNLQLLKKVNLVKEEKEKNFV
    FYAIADQKVKQLLTLLIDISEENIPELKQLQKDLKKHNSNLISLSIPELRNKIKKEDIYIIDLRSKDEFDTGHLPGAHNI
    PFNKIDDEMNKLPRDREMVIY
    CRGRLCPYSDIVGNKLKMAGYNVQTFNNTVWEWQQAVEG

    >gi|58338145|ref|YP_194730.1| putative thioredoxin [Lactobacillus acidophilus NCFM]
    MKLLESNLKINNAVLYFNNDGCSLCYTEKKVIHDLEKNMKQQIPIYSIDARNQKDLVKKYEILSVPSIVFIKNGQKVDQF
    NKYLNGKQIETVFTYYFGSLDND