Kytococcus sedentarius DSM 20547 uid59071

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256823957|ref|YP_003147917.1| predicted transporter component [Kytococcus sedentarius DSM 20547]
    MILTGLVTGALLGFVLQRGRFCITGAFRDVWLSGSTRWLTAFGVVIALHAIGYTALSALGVVNAPVDPLPLGAAVVGGLI
    FGVGIIAAGG
    CATGTYYRAGEGLVGSWFALIFYALSAGAMKYGPLAGFTTWSRDQTVGATTIDASLGLPAWVVVGVLSVG
    VGLAVRHHLRADAARPRTAGLPARRSGVAHLLTEKRWHPFATAAVVAGIALAAWPLSTAAGRVGSLGITTPSAKLGNYLT
    TGDLTMVDWSVMLVLGILAGSLVAALASGEFRVRVPDSTTTLRAIGGGVLMGVGASLAGG
    CTVGHGMVATAQLSWEGWIA
    TGAMLLGAGLGVRWFIRTRDGREAVAGSSPRPTLTPVDTAEGAGADAEPAPQRTRPAPVLTKVGD

    >gi|256823993|ref|YP_003147953.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Kytococcus sedentarius DSM 20547]
    MTTKIDVFVDYVCPFCFLVEPAIEELKRDRDVEVTIRPFELRPDPVPTLRPEDEYLPRVWKQSVYPMSDRVGLPITLPSI
    SPQPRTDKAFMVLQLAQERGLAEAYTEAMFSAFFQQDRNIGLDEVIIDVAASVGLDKAEVEEALRSEERRDRQLADQDYA
    VNTVGIDSVPGIVIEGQVLRGVPSASRLKKVVGDLADRKAASGQGQA

    >gi|256824012|ref|YP_003147972.1| Rhodanese-related sulfurtransferase [Kytococcus sedentarius DSM 20547]
    MDNITPQDLPDDAVVLDVREPEEWAAGHAPNAVHIPLADVPARVDELPDPSTDGPLPVTCRSGGRSSRAVQWLQAQGYEV
    VNVDGGMKAWSAAGKQVVSDAGEPQVI

    >gi|256824044|ref|YP_003148004.1| thioredoxin [Kytococcus sedentarius DSM 20547]
    MATVELTAENFEQTIKDNPMVVVDFWATWCGPCTQFAPVYDAASEKHQDIVFGKVDIDAQPQLAGALGIQSVPTTMAFRE
    QIGVFAQPGAMPATALDEVLEAVKGLDMDEVRAQVEAEQAAAQQQAPQAQQSTTPADAGTRSAGGADPANPFT

    >gi|256824151|ref|YP_003148111.1| glutathione peroxidase [Kytococcus sedentarius DSM 20547]
    MSTLKDFNATTIDGTQQDLGEYAGQVVLVVNTASECGLTPQYEGLEQLHQQYADRGLVVLGFPCNQFGAQEPGSDEEVAA
    FCQKNYGVTFPMFSKIDVNGEGQHPLFAWLKEASGDTSDIAWNFGKFLVGRDGRTVTRIGPRTEPAELTEDIERALGA

    >gi|256824162|ref|YP_003148122.1| glutathione peroxidase [Kytococcus sedentarius DSM 20547]
    MTTLADFSATALDGTDQSLAQYAGQVALVVNTASKCGFTPQYRGLEELYQQHRDAGFVVLGFPCNQFAHQEPGSAEEIAD
    FCSVNYGVSFPMFARVDVNGAGAHPLWRWLKQEKGGLGVSTVKWNFTKFLVGRDGRVIRRYGPATAPARIGADIERALAT


    >gi|256824200|ref|YP_003148160.1| peroxiredoxin [Kytococcus sedentarius DSM 20547]
    MSLINTTIKPFQTTGFVNGEFKDFSDADIQGKWAIFFFYPADFTFVCPTELGDLADYYEELQGLGVEVFSVSTDTHFTHK
    AWHGSSDTVGKVTYPMLGDPTQQISRNFEILREDEGLANRGTFLVDPDGVIQFIEVTSEGIGRNAAELVRKVKAAQYIRK
    NPGQVCPAKWEEGAETLEPSLDLVGKI

    >gi|256824201|ref|YP_003148161.1| alkyl hydroperoxide reductase, F subunit [Kytococcus sedentarius DSM 20547]
    MLDQNLATQLRQLLGNLKRPIELLTTVEADATDATSRETLELCAEIAEMSELVTTREAEGEERADRAPSFRIQAAADTSS
    AVTFAGLPMGHEFTSLVLALLNIGGHPSKAAAETIEQIRGIEGTHRFETFFSQS
    CQNCPDVVQALDLMATLNPNITHVAI
    DGSAFPEEADERGVMAVPTVFLDGEDFGSGRMTLEEIVERIDTGAAEAAADRLADADPYEVLVLGGGPAGSTAAIYAARK
    GIRTGLVAERMGGQVNDTMSIENVSGTSHTEGPKLAADLERHVNDYEVELVKSQEAVGVTPAEAEGGYHSVELASGATLR
    SRSLVIATGASWRTMGVPGEDEYRNKGVTF
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTVLEFMDSMRADQ
    VLQDKLRSLPNVDIVLGAATKEVVGDGSRVTGLKYEERATGESHQLELEGVFVQIGLVPNSAFLKESGVELTDRGEVVID
    GRGATNVPGIFAAGDVSTVPYKQIVVAFGSGSTASLSAFDHLIRTSAPADEPASETAAATKVVDSENEPTDVADLADANS


    >gi|256824272|ref|YP_003148232.1| Thioredoxin [Kytococcus sedentarius DSM 20547]
    MGRARVVSTSGTADPPGVAEPLARVRRVEDLSGLMGERGRTVVVCFSGSWCGSCSLFEPTFEAVAGELADPERAFALVDT
    QELPALATAYAIQTVPTVVVLRDGVVVDRINGVVTARELRRRVSAGGTAGAGPTVAQ

    >gi|256824303|ref|YP_003148263.1| selenophosphate synthase [Kytococcus sedentarius DSM 20547]
    MGWAGAHRGGWADGHSFAYRDAMTDSLRLTQFAAGGGCACKIPAEELEQVVAGLRGQVPATDAAVLVGLDDGDDAAVVQV
    APGVASVSTADFFTPVVDDPRTWGRIAAANALSDVYAMGGTPVMAINLVGWPRAALPMELLTEVLAGGLEIATQAGCPVI
    GGHSIDSPEPIYGMAVTGTADPDRLLRNDAAEPGLPISLTKPVGLGILNNHHKTTGALHPHAIEVMTQLNAAASRAALQA
    GVRAATDVTGFGLLGHLFKMCRASAVAACIDAGAVPCVDGAREALAAGHVPGGSRRNLDWVRPHLSAEGVAEDELLLLAD
    AQTSGGLLVIGEVPGAPVIGETVPAGSLGEGVMVQVR

    >gi|256824369|ref|YP_003148329.1| copper chaperone [Kytococcus sedentarius DSM 20547]
    MTESARTPLPGATNGCSCCAPAADATAPAGRQSADPTGTSAGDATYQVEGMTCGHCVGSVTEAVSALDGVDDVRVELVAG
    GASPVTVTGPASADSVRTAIEAAGYRVRI

    >gi|256824483|ref|YP_003148443.1| dihydrolipoamide dehydrogenase [Kytococcus sedentarius DSM 20547]
    MADHYDVVVLGAGPGGYVAAIRAAQLGKKVAVIEKKYWGGVCLNVGCIPSKALLRNAELAYTLTKEKKTFGIEGDATMSY
    GPTHSRSRKVSEGIVKGVHFLMKKNKITEIDGWGTIQSDSTVSVDLNDGETQEVTYDHLIIATGATTRMIPGVELSENVV
    TYEEQILDEELPESIIIAGSGAIGVEFAYVMANFGVKVTIVEFLDRMVPTEDEEISKELLKHYKKLGVDVKLSTKVEKVE
    DTGSGVKVTVSKDGSEEVLEADRLLSAIGFAPRIEGYGLENVGVETTERGAIDIDQWGRTAVENIYAIGDVTGKLMLAHT
    AEAMGVVASERIAGADTMPVEFDFIPRATYCQPQIASFGYSEAQAKEKGYDVKVSKFPFSANGKAMGFGDARGFVKVVAD
    AEHNEIIGAHMIGPEVTELLPVLTLAQKWDLTADEVARNVFAHPTLSESVKEAVEGIAGHMINL

    >gi|256824514|ref|YP_003148474.1| O-6-methylguanine DNA methyltransferase [Kytococcus sedentarius DSM 20547]
    MTDVTPVGISRPTDDGKGAEHAAIFPIEPDKMADLHTRLAALASEQGLLDVAYRTIDTPIGPLLLAATEKGLVRVAFERE
    NFDTVLESLAQKISPRVLEAPRRLDAVAAEIDEYFNGKRHVFDLPLDYAMSSGFRQMVQRYLPHIGYGHTQSYKEVAELV
    GSPKAVRAVGTACATNPLPVVVP
    CHRVLRADGSLGGYIGGLDAKTALLTLEKAA

    >gi|256824587|ref|YP_003148547.1| methionine-S-sulfoxide reductase [Kytococcus sedentarius DSM 20547]
    MAHLIDPGTPHAVLGTPMGTWPDGSEVIHVAAGCFWGVERFYWQLPGVVTTSVGYMGGTDRRPTYPSVCTGTTGHAETVE
    VVFDPSRVTVDEVLKVFWENHDPTQGDRQGNDIGSQYRSAIFCTTEHQVAVAEATRAAIQEQLTAAGHGAVTTEIVGPDD
    SGEYHLAEERHQQYLHKNPDGYCNHGPNGMSCPVGLVDLPAQTDVEPPRA

    >gi|256824717|ref|YP_003148677.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Kytococcus sedentarius DSM 20547]
    MNAEHYDLVIIGSGSGNSVPQADHADLRVAVVEGGVFGGTCLNNGCIPTKMFVWAAGIADTVRDSERFGIDAELRGVRWQ
    DVRDRVFSRIDPISAGGAEYRRTAAGTDLYEGWARFTGERELEVALRDGSTARLTADQVVIATGASPFVPPALKPLMDSV
    AHTNRSIMRLEDRPEHLTIIGGGVVAVEFAHIFGSLGSRVTLLVRGDQLLKDLPEELAERFGEIAARTWDVRFGTEVAAA
    HEQDGGAVLELDDGSTLRTDGVLVATGRRPNTAALGLEDAGVETDGRGFVVTDAHGRTSSPGVWALGDVRDPVMLKHVAN
    AQARVVSHNLTRPDDLREFPTVPVVAGVFSHPEIGVVGLSAQEARDAGHRVVFHEQEYASVAYGWAMEDTQGRCGVVADA
    DSGAVLGGWVMGHQAATLVNLLGEAILSGEHAHAWARGRYWPHPALSEVVVNALLSLALQEPQEPTT

    >gi|256824756|ref|YP_003148716.1| hypothetical protein Ksed_09030 [Kytococcus sedentarius DSM 20547]
    MSENTQQPAVEMFFDPTCPWAWMTSRWLMEVEQVRDIQVTWSPMSLAVLNEGRDLPEDYAAAMQAAWGPVRVISAAITEH
    GEKQAKALYDAMGKRFHPGGRKNVEEGQAVIAEALAEVGLPAELADVAFPQGVGSNPEDEITADLRERQQRVVDLVGDDV
    GTPVIAVDGVAFFGPVVTPAPKGEDAGRLWDGCVLVASTPGFYELKRSRDAGPQFD

    >gi|256824830|ref|YP_003148790.1| glutaredoxin-like protein [Kytococcus sedentarius DSM 20547]
    MERHLWILALLAGGWATAVYALDGAVLPALGLGLLTLVATVLSSPWWRGRSERHAALVALPDHERPVVVYWRPGCMYCAR
    LRRGLGRVGRRARWVNIWQDAEARAFVRSVNDGNETVPTVVIDGRAHTNPDPALVRQRLEAV

    >gi|256824853|ref|YP_003148813.1| Peroxiredoxin [Kytococcus sedentarius DSM 20547]
    MTTRLQTGDQAPEFTLPSSEGGELSLSDLRGRKGVLFVYPAASTPGCTTEACDFRDNAAALAEAGYTVLGLSKDTVEKNA
    KFAEKHELGYPLLSDPELETLKAYGAYGEKKNYGKVVQGVIRSTFVIDEEGVIEHARYNVRAKGHVASLGKNQLKLPLTS
    AV

    >gi|256824896|ref|YP_003148856.1| thioredoxin domain-containing protein [Kytococcus sedentarius DSM 20547]
    MPVTTLTDDTFESAVTSAEAAVVVLTDAHCSTCGHYTTVVERVAEQMADEAEFYFVSHDSAPEVYASSGVRSVPTTVIFR
    QGMLLHLDSGAHTEENLAQLVHVFAEADVEEMRQAVQEQGTTVIGQED

    >gi|256824908|ref|YP_003148868.1| copper/silver-translocating P-type ATPase [Kytococcus sedentarius DSM 20547]
    MSTPPVLDNSPIELDLQGMTCASCANRIERKLNKLDGVEATVNYATEKARVQAPAGYDPQLLVDEVAKAGYTASLPAPPR
    DETGTAGETDAAGNADPELHSLRQRVIISAALTVPVIAMAMVPALQFTYWQWASLTLAAPVIVWGAWPFHKAAWTNLRHG
    AATMDTLVSMGTLAAFGWSLYALFLGTAGTPGMTHPFEFTVAPSDGAANIYLEAAAGVTLFILLGRYFEKRSKRQAGAAL
    RALLELGAKEVTVLRDGREVTVPAGELQVGDEFVTRPGEKIATDGEVVSGSSAVDASMLTGESLPVEVGPGDTVTGATVN
    AGGRLVVRATRVGSDTQLAQMARLVEDAQTGKAEVQRLADRISGVFVPIVIGIAVATLGAWLGAGFPATAAFTAAVAVLV
    IACPCALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRTVDTVVLDKTGTVTTGEMTLADAVSAEGSDREDVLRAAGAL
    ESSSEHPIARAIVAGARAELGDLPTPTDFSNLEGRGVRGTVDGHRVLVGRPALLADEGMPLGAHLQEALEAAQQQGRTAV
    AVGWDGAARGVLVVSDTVKTTSAEAIDRLRGLGLTPVLLTGDNEAAARHIAAEVGIEEVIAEVLPQDKVDVVRRLQEQGK
    VVAMVGDGVNDAPALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRRTLSTIKTNLFWAFAYNVAAIPVAA
    LGMLNPMLAGFAMAFSSVFVVGNSLRLRGFRSVSA

    >gi|256824910|ref|YP_003148870.1| copper chaperone [Kytococcus sedentarius DSM 20547]
    MSTTEYTVTGMTCGHCEMSVREEVSEVPGVQDVQVSHETGRLTVDGSDDVNQDAVIAAVEEAGYSAVRA

    >gi|256825032|ref|YP_003148992.1| rhodanese-related sulfurtransferase [Kytococcus sedentarius DSM 20547]
    MTTPLTSPEELSELLTRQDRARPTVLDVRWDLGGGADRRGFAAGHVPGSLFCDLEEVLTGPLAADGSGGRHPLPATGAVR
    AWLAGHRIEDDTPVVLLDAGHGAGAARAWWVLRDAGLQDVRVLDGGLAAWQEAGLPVETGPPPAPRPGRNPGAGLPGDPP
    GEPAPHVLPLRTASDLEQGLPRNEVLLDARPARRYAGEDLGPDPVGGHVPGAVNLPVGSLYADGRLREAETVRARFAEAG
    VGADTAVVVS
    CGSGITACQLALAHRQVFPGAPEPQLYAGSFSDWISDPRRPLAQGDQPGALPGGPGG

    >gi|256825128|ref|YP_003149088.1| protein-disulfide isomerase [Kytococcus sedentarius DSM 20547]
    MPVDNSPRPSGAHRPAGSSGGGVSKALIALIAALVVGALVVLGIWLLGQGDDDDSTAAPSSSTNSQSGSGDPSSGTPADM
    AVPQGMPEKPAGVTVGEAGGPELIIFEDFQ
    CPACKSFEDLLGDDIATMIDDGKAQVTYFPKTFLDGNLGTDHSERAASAA
    FCASDGGKFREYHDALFANHPEREGDGWTDEQLKGFGKDAGLEGDALATFEKCVADGTYREYAKASEARSSEMGVMSTPT
    VYLNGQRMELTNAEDFRKQVDEAGAPQKSDASPSAS

    >gi|256825374|ref|YP_003149334.1| hypothetical protein Ksed_15540 [Kytococcus sedentarius DSM 20547]
    MTPLPHLVQGYAAALPELSQPWEAASVPEPRLLALDEAVAADLGLDAGWLASAAGLAFLTGDLSALPDAPPTVAQAYAGH
    QFGGFSPLLGDGRALLLGELTDAAGRTVDLHLKGSGRTPFARGGDGKAAVGPMLREHLMSVFVHAVGIPTTRSLAVVATG
    EQVLREVALPGAVLARVASSHLRVGTVQHAAASHGPEVTARLVRYALERHHPELLGTPEPPALALLRSVADAQARLVAQW
    MGVGLVHGVMNTDNMTLLGETIDYGPVAMLEAHDPQAVFSSIDTQGRYAYGNQPAIAQWNLARLAEALLPLIDDDADAAV
    ERATEVVTGFAQTYRAEHTAVFSAKLGLAEPDAGRVAEYLEHLTAEGLDHTASFRALADEAEAAGDPERAARLRAVNPVY
    VPRNHVVEEVLAAATAGDLAPFERLVGALREPFTERPGLDDLARTAPEGCPPHVTF
    CGT

    >gi|256825384|ref|YP_003149344.1| methionine-R-sulfoxide reductase [Kytococcus sedentarius DSM 20547]
    MDIPILNSAKYAKGRDDSEWREELSAEEYAVLRQAGTERPGTGKFDSFDSPGTYSCRACDTELFRSSTKFDASCGWPAFF
    APLADDRVEYLKDNSLPGRPRIEARCAACGSHLGHVFEGEGFDTPTDLRY
    CINSVCLTFTPDGGEEAIRGTQD

    >gi|256825447|ref|YP_003149407.1| Iron-sulfur cluster assembly accessory protein [Kytococcus sedentarius DSM 20547]
    MTVQDTTTSEATHGVTLTPVAAEKVKSLLDQEGRDDLRLRIGVQPGGCSGLIYQLYFDERTLDGDATRDFGGVEVVVDRM
    SAPYLEGAAIDFADTIEKQGFTIDNPNAGSSCACGDSFS

    >gi|256825454|ref|YP_003149414.1| dihydrolipoamide dehydrogenase [Kytococcus sedentarius DSM 20547]
    MPSSTPTHDLVILGGGSGGYAAALRAAELGLTVALVEKGKLGGTCLHSGCVPTKALLHAAEVADSTRESDTFGVNATFEG
    IDMGRVNSYKEGIIGRLHKGLQGLVKSRKVEYVEGEGRLTAPNTVTVGDRELVGKDVVLATGSRPKLIPGLEVGGRVMTS
    EQALQLDTVPESVVVLGGGVIGVEFASVYTSFGAKVTVVEGLDRIVPAEDEAVSKTLNRAFRKRKIDVRTGVRFQSVDNR
    EDGVTVTLEDGTELEADMLLVAIGRGPVTEDMGFEEAGVTLDRGFVTVDEKLRTSVDHVWAVGDIVPGLQLAHRGFAQGI
    FVAETIAGLDPTPIDESGIPRVTYCDPEIASVGLTEAAAKEKYGEVESVEYNLGGNGKSQILGTQGFVKLVRRTDGPVVG
    IHMVGARIGEQVGEAQLIYNWEAMPEEVAALIHAHPTQNEALGEAHLALAGKPLHAHN

    >gi|256825726|ref|YP_003149686.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Kytococcus sedentarius DSM 20547]
    MSPAVIDPEPSPATAEPRMPGPGHPLTDMAGEFDRATVQRYARHIATPGIGMVGQRRWSAARVAVVGLGGLASPVLEYLA
    GAGVAEILVADVDAVELSNLQRKPIFATEWVGRPKVEAAAAGVHRINDRVTVRPVEGYVTEENALELLERYDVIVDCTDH
    AASRRVLARVSAELGVPHVWGSVEQFGGRVAVWWPPYGPCSECTPDIEPSSSTELKFTEAGVFGPVTGQVGMVMVSETLK
    LLLALGEPLLGWILHVDTLTQQWTDDRRAADPQCPVCRPAAANERAWAQTEAIPLAAGEDAWEPPLIGATTLQEMLQNRE
    EFEPFVLLDVRGAHEREVASLEGSFHLELDEVRQGAAREVFGPHDNVVVY
    CRNGRRSAEAARQLHAQGMQGVYVLDGGLM
    QWAQEVDPDLPIW

    >gi|256825740|ref|YP_003149700.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Kytococcus sedentarius DSM 20547]
    MGPAAVHPDPPTPRRLAPLVEPAGELSVAQVERYARHVLLPRLGLTGQRRLRAARVAVVGAGGLGCPVLQYLAAAGIGAL
    TLIDDDLVESSNLQRQVLHGLDDVGRPKAVSAAESLRATGTETELHVVQRRVTAENAVDLLRGHDLVVDGTDNFPTRYVL
    DAAAAELGLPVVWAALMRDQAQLTTFWAAPRPAPGTPPVDPVRLTDLFPHAPDPATVPA
    CGDAGILGALCGLVGSALALE
    VVRLVTGTGESMLGRLVFVDAAAMRFAELPLAGAGRAGVPAGDAPVHHAQPEEPTRAAHPSERAAATESAGRGEPADAPE
    VTPTALAAALASDARPVVLDVRSPGELAMGVVPGAVHLPLDRILDDPAAARAELRAAGVLGAAGLAGGPEPDTGEGGPRE
    GGPAVVCVCKAGVRAALAADHLRRWGVPGVSVLAGGMLAWREQVDPSLPRY

    >gi|256825814|ref|YP_003149774.1| cation transport ATPase [Kytococcus sedentarius DSM 20547]
    MTNTALQHTTLRAQGFSCPSCVSKIEKQVQRLPGVEKVEVKFASSRVEVDHAESVTPEDLVAAVRKAGYESSPSVF

    >gi|256825922|ref|YP_003149882.1| Rhodanese-related sulfurtransferase [Kytococcus sedentarius DSM 20547]
    MTTMTNLAPTTESTSGQESGTPGIRSVADLRRALDAGGQTPLLLDVRTDGEFGAGHVPGAVLLPLHRIQEDPARVARELS
    ACGEVVVI
    CRSGNRARSAAEALRGHLPAASAPAVLEGGMVAWEQAGGETREGTGTGVWDMQRQVRFVAGAMVLTAVVAST
    RVPAVKWAAAGVGAGLATSGATGACPMAGALALMPWNRGTSLEDGLCAVRERHAGG

    >gi|256825924|ref|YP_003149884.1| Zn-dependent hydrolase, glyoxylase [Kytococcus sedentarius DSM 20547]
    MQIEIIETPSLGDRSYLVHDDREALVVDPQRDIDRVLEAAERAGVTITAVAETHIHNDYVTGGHALAQQVGATYYVNAED
    EVSFERHGIRDGEEFAVGSLTVRALSTPGHTFTHLSYVVTPADGSEPAVFTGGSLLFGSTGRPDLLGPDHTEALAHHQYD
    SAHRLARELPDETRIMPTHGFGSFCSATQTAGDSSTIGAERQQNPVMHQERDQWLAELYEGLAAYPAYYRHMAPANASGP
    SAAVLERPAVADREVIADALAAGHWVVDLRSRRAFAEGHVEGTISIDLEGQFATYLGWLIPWETPLVLLGQDADQVDEAV
    RELSRIGIEETLAGHATGSPSDWTDRAVQSFPQATFAQLRDVRHHREVTIVDVRQRAEWEDGHLEGAVNLPLTQMGDLRQ
    GELVAGLDPRAELWVH
    CAGGFRASVAASLLARAGHRVVAIDDGFDNAANSGLAITP

    >gi|256826205|ref|YP_003150165.1| thiol-disulfide isomerase-like thioredoxin [Kytococcus sedentarius DSM 20547]
    MLPGDNPSRRLLLTGGAAGLGTLLLSACGEDGGNTVTGRARGEGDAGYISGDGTVEQVAADQRRDPVTLVGQTLDGKDFA
    LDQVEKKVVVLNTWGSW
    CPPCIEEMPVLQEFWENYAEQDVLLLGLVQRDSVETAQAFLRSREITYQNLRDNGGGTLRGLQ
    GATAATPTTLVLDAQRRIAARVSGPVELSTLTTLVDDVLAEDA

    >gi|256826237|ref|YP_003150197.1| O-6-methylguanine DNA methyltransferase [Kytococcus sedentarius DSM 20547]
    MTDKTATDHPPQRCHRILQTPVGQVTLVGDGQVLEGLYWPDHTPAPDRSTFGPCAPEAFTDAMTQLQEYFAGERVEFSLA
    TRAEGTDFQQAVWEQLRMIPAGETRTYGQVAAAIGRPTAVRAVGAANSRNPLSVIVP
    CHRVVSASGAAHGYAGSVETKEW
    LLAHERRHRA

    >gi|256826329|ref|YP_003150289.1| mercuric reductase [Kytococcus sedentarius DSM 20547]
    MPTKYDLAIIGSGGGAFAAAIRATTLGKSVVMIERGTLGGTCVNTGCVPSKALIAAADARHSAADAADRFPGIATTAGPV
    DMPALIAGKQALVESLRGEKYADVADSYGWAVRRGDAAFAGTPDAPVLQVAGDDGSTETIEAGHYLVATGSRPWAPPIDG
    LDQTGYLTSTTAMELTELPESLLVLGGGYVALEQAQLFARLGSQVTVLVRSRLASKEEPEVSRTLQEVFADEGIRVVRRA
    LPTRVSRDAATGQAVVTADVAGGREEFRADQVLVALGRRPATDGLGLDRVGVKTGDLGEVVVSDRMQSSHPRIWAAGDVT
    GHPEFVYVAAHHGTLVAENAFADADRAVDYARLPRVTFTGPAIGAVGMTEKDVVAAGIRCDCRVLPLHHVPRALVNRDTR
    GFVKIVVDADTGKILGITAVAKDAGELAAAGVHVLGKTVAEVADAWAPYLTMAEGIRIAAKAFTTDPSLLSCCA

    >gi|256826449|ref|YP_003150409.1| thioredoxin-disulfide reductase [Kytococcus sedentarius DSM 20547]
    MSIFTQTSAVALNAQPATQSETSPAGEGEVREVVIVGSGPAGYTAAVYAARANLRPLVFEGSVTMGGALMNTTDVENYPG
    FTDGIMGPDLMMQMRSQAERFGAELVTDDIVEMDLTAPVKTLRDGSGTTYRARTVILAMGSAYRELGLPREKELSGHGIS
    W
    CATCDGAFFREQHIAVVGGGDSAVEEATFLTRFADKVTLVHRRDELRASQIMSDRAHADPKIEFAWNSEVAEIHGDAKL
    TGITLRDTVTGQERELPVTGLFIAIGHDPRNELLTGQVDLDESGYVMVEGRSTRTNLEGVFAAGDLVDHTYQQAITAAGS
    GCQAALDAERYLSTLDSSPVDTAQIEPAADERVPGDVPA

    >gi|256826450|ref|YP_003150410.1| thioredoxin [Kytococcus sedentarius DSM 20547]
    MAGTETTTDATFDQDVLKSELPVLVDFWADWCGPCKRVAPILEEIAKDSEGKLRIVKLNTDENPQTAARYGITSIPTMHV
    FFQGDVAKTIIGAQPKPKLLKELEPFLG