Kribbella flavida DSM 17836 uid43465

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284028034|ref|YP_003377965.1| methylated-DNA/protein-cysteinemethyltransferase [Kribbella flavida DSM 17836]
    MRWSVIDSPIGDLCLAVDDTGLCCVRFGAVDDVEPLTVPDPLLTETHEQLKAYFAGERTTFDLPLSVPAGSTFERAVWQQ
    LTRIPYGEMQTYGDVAKAVGDPGAARAVGVACNRNPLPVVVP
    CHRVVGAGGKMVGFGGGIPRKRHLLELEARVAFENLWT


    >gi|284028155|ref|YP_003378086.1| Rhodanese domain protein [Kribbella flavida DSM 17836]
    MTQNPMLPSVPSVVVNDVDDDLLAEAFVLDVREPDEWASGHIAGATHIPLGQLQERVGEVPLGQKVLCVCAVGGRSGVAT
    QYLVSEGREAINLDGGMHAWQAFGRPVTTD

    >gi|284028177|ref|YP_003378108.1| methylated-DNA/protein-cysteinemethyltransferase [Kribbella flavida DSM 17836]
    MNDLERRLAQLGGPRPSRPPVLPEADVSYTLHDSPIGRLLLAVAGGKVVASSFGDEETLTNRLAQTISPRVLRQAGPLDD
    VRRQLDEYLDGRRKTFELAVDLTLATPFQRLVLSDLPQHTSYGRTTTYGELAGEIERPKAARAVGTALGANPLCVVLP
    CH
    RVIGANGALTGYAGGLDAKRFLLNLESKS

    >gi|284028447|ref|YP_003378378.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kribbella flavida DSM 17836]
    MGCAPEASREGEGGETPQSPDSSRTVAGAEKLADCPSTPSRPPVSDGLPDVSLPCLGNGPDIRLADLRGPLLVNVWAQWC
    GP
    CRDEAPYLADLQQKSGGKVQLIGIDYADPRPEKAIEFAVEHGLVYPHLADTDKQVRQPLRVGGPPLTAFVDKAGKVVH
    VHRGVFKSQQELDQLVRTKLGVTW

    >gi|284028587|ref|YP_003378518.1| periplasmic binding protein [Kribbella flavida DSM 17836]
    MAVVPKAVLAAVLLSLIAACGAAAEAGPRAASTTVKNCGLDIGVDGPPERVFAAYQPAVELAHALGISDRLVGTAYLDAQ
    VLPPYAEAQRDRKYYKNLPSREELLSLNPDFVLSGFNDVFSSAGSDSSFGTRGSLAQLGVQTWIFSPL
    CPTADGKGDEAI
    DPSTVSMDNVYADLRDLGRLFGVSDRAEQVIADQQARIAAVQAKVQNAPRPTVAILRPGLEGGGMTVSAGPDFGSVLIRQ
    AGGVNAFAGLTSKRNVKLSVEQFIRTDPDYILVSGCCDASLTEAQVQPEVQKILGNPALANLKAVRNKRVVPWLFAHHSA
    GVRGASSTELIAKIIHPDLVK

    >gi|284028774|ref|YP_003378705.1| Rhodanese domain protein [Kribbella flavida DSM 17836]
    MAVGHFCHCSPACPLRHAEGSTRSRSSPMSAVLQTPPAAAQTAAAHFAGRLAFETDPSDVAADIGAGVTGWVLVDSRSQE
    SWDQGHVPGALHLPTREIAARAASVVPAGAAVVTYCWGPA
    CNGGTKAALEFAKLGYPVKEMIGGFEYWTREGLPVETSEG
    ITRRPVDPLVAPRNVACAC

    >gi|284028953|ref|YP_003378884.1| hypothetical protein Kfla_0980 [Kribbella flavida DSM 17836]
    MSSGIVVLVAALAAGVLLSVLKTWYDGRFRATRVIEGRAVDETERPADRVTAEDIGAELGERATLLQFSSAFCAPCRATR
    RVLAEVESMVDGVRHVEIDAESHLELVRRLNIMRTPTVLVLDAAGGTVTRASGQPRKADVIAALGAAVDRRAS

    >gi|284028956|ref|YP_003378887.1| Rhodanese domain protein [Kribbella flavida DSM 17836]
    MSRESALVSADWVEEHKSDENVVLIEVDEDVSAYDAGHIAGAIKLDWKEDLQDPVRRDFVNQEQFQALLSERGVGNDDIV
    VLYGGNNNWFAAYAFWYFKLYGHADVRLLDGGRKRWELDSRELTDEVVKREATQYTANAPDLSIRAFRDEVQEAIGVKNL
    VDVRSPDEYAGRLLAPAHLPQEQAQRAGHIPTAASIPWSKAANDDGTFRSDDELKKLYADAGVDFGKDTIAY
    CRIGERSA
    HTWFVLHELLGQENVKNYDGSWTEWGSLVGVPVALGDEPGKA

    >gi|284028963|ref|YP_003378894.1| hypothetical protein Kfla_0990 [Kribbella flavida DSM 17836]
    MSRTLVIKLTAGAEEPERANQACTVAATAVASGATVSLWLTGDAVWFAVPGRADAVALPHAAPLADLIAAVLAGGRLTVC
    TQCAKRRDLTETDLLPGTRIAGAPSFTEEILTENAQAIVY

    >gi|284029030|ref|YP_003378961.1| heavy metal translocating P-type ATPase [Kribbella flavida DSM 17836]
    MTTPEAGQSVELIIGGMTCASCAARVEKKLNRMDGVTATVNYATEKAKVTYAEGISTDDLVATVEATGYTAALPAPPAGD
    RGGDEAGHVVPDELKPLRQRLVTSIVLAVPVIALGMIPALQFDFWQWASLTLAAPVVTWAAWPFHKAAWTNLRHGAATMD
    TLISLGVVSSFLWSLYALFLGGAGEPGMKMPFTLIPSRGGGTEEIYLEVAAGVTTFILAGRYFEARAKRRSGAALRALLE
    LGAKDVAVLRNGTEVRIPADQLSVGDEFVVRPGEKIATDGVIVTGSSAVDASMLTGESVPVEVGAGDPVVGATVNAGGRL
    VVRATRVGGDTQLAQMARLVEDAQNGKAEVQRLADRISGIFVPIVIGLALGTLGFWLGNGSAVEVAFTAAVAVLIIACPC
    ALGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTVTTGRMDLVDVLLAEGEQRADVLRLAGALEHSSE
    HPIAQAIARGATDELGKLPPVEDFGNVEGLGVQGIVEGHAVLVGRTKLLEEWSQYLPDELAHAKERAETEGSTAVAVGWD
    GKARAVLVVADTVKPSSAEAIQQLRGLGLRPVLLTGDNEAVARKVAAEVGIDEVIAEVLPAGKVDAVKELQAEGRVVAMV
    GDGVNDAAALAQADLGLSMGTGTDVAIEASDLTLVRGDLRSAADAIRLARRTLGTIKGNLFWAFAYNVAALPLAAAGLLN
    PMLAGAAMAFSSIFVVSNSLRLRRFRPLTQQP

    >gi|284029074|ref|YP_003379005.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Kribbella flavida DSM 17836]
    MANPSESTTFDVVIIGAGPVGENVADRVVQGGLSAAIVERELVGGECSYWACMPTKALLRDAAAVRAARALPAAGQAVTG
    GLEVAAVLARRDRFASNWSDTGQAEWLDQAGIALVRGHGRITGTRVVTVTGTDGTSRVLQARHAVVIATGSSAQLPPVLC
    LADVAPWASREAAAARTVPDRLAIIGGGVVGSEMATAFSALGSHVTLISQTRLLPGVEPFASDQVTAALRAAGVSLHLKL
    DATEARRDTSGTVHLTLSDGRLVAADEVLVATGRTPNTKDLGLDHLGLTPGAWLPVDDALAVVGDDGKPVGDGWLYAAGD
    VNKRALLTHHGKYQARALGDAIAARAHGQELDLAAWGRHAVTADERATTQVIFTDPEVAAVGLSAEAASAAGFRIRVVDH
    DLGAVAGAALHADGYRGQARMIVDADRNVLIGFTAVGPDVAELLHAATIAVTAEVSLDRLWHAVPAYPTISEIWLRLLEA
    DGRRTRLT

    >gi|284029075|ref|YP_003379006.1| organic hydroperoxide resistance protein [Kribbella flavida DSM 17836]
    MSQPLYTAMATSTGDGRAGGRAASNDGLLDVTLAVPHEMGGPGGATNPEQGGFSLSAALHAEFGGIDEATADALVAAAHT
    I
    CPYSNATRGNIPGTVDATVA

    >gi|284029818|ref|YP_003379749.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kribbella flavida DSM 17836]
    MSERLSVGDAAPEFTLPDADGNEVSLRDLRGRNVILYFYPAAMTPGCTKQACDFRDSLDSLAAAGYAVLGVSPDKPAKLQ
    KFRDRDGVTFPLLSDPDKDVLTTYGAFGEKTMYGKKVTGVIRSTFVIDAEGKIAVALYNVKATGHVAKLRRDLGL

    >gi|284030180|ref|YP_003380111.1| OsmC family protein [Kribbella flavida DSM 17836]
    MATIRTAKAHWEGSLMEGAGQVALESSGIGTYDVTWASRANEANGKTSPEELIAAAHSTCFSMALSHALAGAGNAPESID
    TSAEVSFQPGEGITGIKLSVNGKVPGLTAEQFAEFAEQAKKN
    CPVSQALAATPITLDVNFTA

    >gi|284030193|ref|YP_003380124.1| hypothetical protein Kfla_2249 [Kribbella flavida DSM 17836]
    MTASADFWFDPACPWAWMTSRWMLEVEQVRDVRTTWHVMSLAVLNEDREDHDAIWQRKLGIVRVLIAAEQAHGNEVLLPL
    YTALGNRIHVDGRGTNGSDGDVLAEALAEAGLPASLLEAAGTDKYDEALRKSHHAGMDQVGMEVGTPVIAVEGVAFFGPV
    VTPAPKGEAAGKLWDGVRLVAGTEGFFELKRTRDREPIFD

    >gi|284030272|ref|YP_003380203.1| transcriptional regulator, HxlR family [Kribbella flavida DSM 17836]
    MRRSSFSPEPDCAIAQSLAVVGDGWELLIVRDLARGLDRFDLLAESLRISRKVLTERLGGLMDSGVVERTAYQERPTRYA
    YQLTARGRALLPVLVALQDWGDRWVLGDGQLTGTNAESEPTAHRLHELVGAAVPAGLLLPATGGDGPPESVDVVDGQAKA
    TVLFGYPATGRPTPLPAGWSEIAGAHG
    CTLENRLFAERYDEFRAGGIAVHGVSTQRPEEQAAFAEAEKIPHVLLSDVELQ
    LAAALRLPTFRAGGVGRLKRFVLVVGADRVVRAVRYPVTDLADAVNWAFTTASDQAGGGAERRG

    >gi|284030381|ref|YP_003380312.1| OsmC family protein [Kribbella flavida DSM 17836]
    MTDSMVAVELDRSRGGSLEALLALPSGEVRAYAVLAHRSAAAAAVIAETLAGSGLAVLLFESTDVEDVVRAADHLRANFE
    APSVLIGHSAGGVAVLAASRRIAETRAVVTVNAPSGEIPPAHTALLVMHAPTDQVVGIQHAGHLFVAARHPKSFIALDGA
    DHLLSDPADAAYAAAVLAAWVARHLPAAGTPAPSAAELAHRVVVTESADAPYGQRITAGRHQLTADEPVPLGKDTGPTPY
    DLLLAALGA
    CTSMTLRMYAERKQLPLRQVSVQLRHARIHATDCENCETAVGLLDRIDVRIQLDGDLTDEQRDRLLAIAGK
    CPVHRTLHSEVQIRTSLDG

    >gi|284030491|ref|YP_003380422.1| thioredoxin [Kribbella flavida DSM 17836]
    MATVELSQQNFDEVVGSDGLVLVDFWAEWCGPCKMFGPVFEKSSETHSDITFGKVDTEAQVELAQAFQIRSIPTLMAVRD
    GVVLYSQPGALPAAALEDLISQLRAVDMEEVRAQIAAHEAEHGTEPHTH

    >gi|284030515|ref|YP_003380446.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kribbella flavida DSM 17836]
    MSPAAVPVVGSLAPDFTARTQHGEPVRLSDLRGRRPVVVVFYPYAFSRVCTSELGALRDRPDLLAAAEFLAVSCDPMFTL
    RAYAEAERLEFALLSDFWPHGAIASSYGVFDADRGCALRGTFVIDPDGVVRWSVVNPNADARDPDDYARALAELGCGLG

    >gi|284030624|ref|YP_003380555.1| dihydrolipoamide dehydrogenase [Kribbella flavida DSM 17836]
    MTNPADSTTFDLVILGGGSGGYAAALRAAVLGLSVALVEKDKLGGTCLHRGCIPTKALLHAAEVADSAREGEQFGVRTTL
    EGVDMGGVNKYKDGVVDRLFKGLQGQIKARGITVVEGEGRLTSPTTVEVAGTTYTGRNVVIASGSYSRSLPGLELDGQRV
    IASEHALTLDRVPESAVILGGGVIGVEFASAWTSFGTKVTIVEALPRLVPAEDADCSKTLERAFRKRKIAFKTGTPFESV
    EVVDNGVRVTVAGGEVIEAEVLLVAVGRGPNTAGLGYEEVGVTLDRGFVTVDEHLQTSVPGVYAVGDIVPGLQLAHRGFQ
    QGIFVAEHIAGLNPAPIDEAGIPRVTYSEPEVASVGLTEEQARAKYGEVEILNYNLGGNGKSQILKTQGFVKLVRAKDGA
    VVGLHMVGSRVGELIGEAQLIYNWEAFPADVAPLVHAHPTQNEALGEAHLALAGKPLHFHE

    >gi|284030701|ref|YP_003380632.1| iron-sulfur cluster assembly accessory protein [Kribbella flavida DSM 17836]
    MTEAQTEQAATTATGIALTDGAAAKVKALLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERQLDGDVVADFDGVSVVTDR
    MSAPYLKGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|284030954|ref|YP_003380885.1| thioredoxin [Kribbella flavida DSM 17836]
    MSTLQIVDESNFAEVVLGADKPVLVDFWAQWCPPCHQVLPVLEQIAAERADRLSIVKLNADENPVISSSYRVMALPTLIL
    FHHGEQIWSVVGARPKAWLLKNLDDALLTTV

    >gi|284031007|ref|YP_003380938.1| glutamate synthase, NADH/NADPH, small subunit [Kribbella flavida DSM 17836]
    MADPKGFLTTPREVAERRPVAERVQDWNEVYPGGPGKALLPIITKQAGRCMDCGIPFCHSGCPLGNLIPEWNDLVWRDDW
    TGAIERLHATNNFPEFTGRLCPAPCEPACVLGINQEPVTIKNVEVAIIDKAWESGDVRPQPPEWLTGKTIAVVGSGPAGL
    AVAQQLTRAGHTVAVYERASAPGGLLRFGIPEFKMEKVQVERRIQQMKEEGTVFRSGVNVGVDVTGTQLQQRYDAVVIAT
    GATAARDLPVPGREFAGIHQAMEYLPQANRVALGETVENQIVATDKDVVIIGGGDTGADCLGTAHRQGARSVTQLEIMPR
    PSDERPAGQPWPTYPMIYRVASAHEEGGERVYSVSTNNFVADENGHVAGLNLVEVELVDGRFTPIEGTERTIPAQLVLLA
    MGFLGPEKEGFLEQLGVELDERGNVKRDKAYQTSVEGVFACGDAGRGQSLIVWAIAEGRSCANGVDAFLTGSSTLPTPIP
    PTARPLVV

    >gi|284031402|ref|YP_003381333.1| Rhodanese domain protein [Kribbella flavida DSM 17836]
    MNPLITAGELLDAPDDVVVIDVTWNLAGPPGREAYDAGHVPGAHFVDLDTELAGPPGDGGRHPLPSASVVEAALRRAGAG
    PDSSVVVYDAANSMAAARARWVFRYFGLRDVRVLDGGLAAWRAAGGEVSTEVPADAAGSFVAVPGGLPVLDAAGAAELAS
    SGVLLDARAPERFAGEVEPMDKVAGHIPGAVNAPTTGNVGPDGRFLPADDLRARFAALGADGSRPVGAY
    CGSGVTAAHES
    LALEIAGLDAAVYVGSWSEWITDPDRPVATGPA

    >gi|284031496|ref|YP_003381427.1| dihydrolipoamide dehydrogenase [Kribbella flavida DSM 17836]
    MASHFDVVVLGAGPGGYVAAIRAAQLGLKTAIIEKKYWGGVCLNVGCIPSKALLRNAELAHIFGKEAKTFGISGEVSFDF
    PTAVQRSRKVADGRVKGVHFLMKKNGITEFDGWGSFVDANTLDVALNDGASETVTFDHCIIATGATTKLLPGTQLSDRVV
    TYEEQILTEELPGSIVIAGAGAIGVEFAYVLANYGVKVTIVEFLDRIVPLEDVEVSKELAKAYKKLGVDVLTSTRVDTID
    DSGDKVKVTVTGKDGNQQTLEADKVMQAIGFQPRVDGYGLDKIGVKLTERGAIDVDGFLRTNVPNIFAIGDVNAKLMLAH
    AAEAMGVIAAETIAGHETMELDYVMIPRATFCQPQVASFGYTEEQAKEKGYDVKVAKFPFTANGKAHGLGDATGFVKVIS
    DAKYGELLGAHLIGPEVTELLPELTLAQKWDLTTKELARNVHAHPTLSEALQEAFHGLEGHMINF

    >gi|284031619|ref|YP_003381550.1| OsmC family protein [Kribbella flavida DSM 17836]
    MTIAVEKVVYTARATAEGGREGHTASDDGKLDVTVAPPKEMGGNGEGTNPEQLFAAGFASCFHSALKLVARRARQDSEGS
    TVTAEVGIGPVNGGAAYGLEVALVVSLPGVERVIAEELVAKAHQV
    CPYSNATRGNIKVDLTLA

    >gi|284031648|ref|YP_003381579.1| methionine-R-sulfoxide reductase [Kribbella flavida DSM 17836]
    MTDGTKQYAIEKTDEQWRAQLSPAEYQVLRKAGTERPFTGEYTDTKTVGVYRCRACEAELFRSETKFDSHCGWPSFFAPL
    AEDRVEYIEDTALGMKRVEVRCANCGSHLGHVFEGEGYGTPTDLRY
    CINSVSLTLDPA

    >gi|284031655|ref|YP_003381586.1| Peroxiredoxin [Kribbella flavida DSM 17836]
    MSLYDIPLRTLSGGETSLADYRGKAVLVVNVASKCGQTPQYAGLEELQQKYARRGFTVLGAPCNQFGGQEPGTAEEIEAF
    CATTYGVTFPMLDKLEVNGDSRHPLYQELTQTPDAEGRAGDVQWNFEKFLVAPDGTVAARFRTSTTPDSPDLVTTLEQHL
    PT

    >gi|284031903|ref|YP_003381834.1| glutaredoxin [Kribbella flavida DSM 17836]
    MCATYFPHTRAGDPVVVHGRRGCGLTQGVRRYLDRADIPYHYVDLDLNPLDETRLAWITGGRVHSPVVSVGGEVLVQPTT
    SELELTLTTRGLPIGVTTQHQRART

    >gi|284032588|ref|YP_003382519.1| Peroxiredoxin [Kribbella flavida DSM 17836]
    MTTVYDFSAQRIEGNEQSLADFRDQVLLVVNTASQCSQTPQYSGLQKLYKTYRKQGFSVLGFPCDQFGHQEPGDENEIAN
    FCSTIYHVTFPMFAKIDVNGSKTLPLYNWLKREAGGLLGGRIKWNFTKFLIGRDGQVIARYAPANTPEKLAGKIEAALAV
    PAPSRRDSGD

    >gi|284032623|ref|YP_003382554.1| hypothetical protein Kfla_4738 [Kribbella flavida DSM 17836]
    MTRQPRLEIEYCTQCRWLMRAAWTAQELLTTFSKELGEVALIPGTGGVFDIRLDGETLWSRKAEGRFAEIPALKQLVRDR
    IAPGRHLGHSDRREPAAEAVMGDTSPNRDVNL

    >gi|284032670|ref|YP_003382601.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Kribbella flavida DSM 17836]
    MYDVIVVGGGAAGLSGALALVRARRSVLVVDRGDPRNAPADGVHNFLTRDGTPPAELTALGRAEVTGYGGEVITGTVTSA
    RPTGDAEIGFEVELTDGRTFQARRLLVTTGVTDQLPDVPGLAERFGRDVLH
    CPYCHGWEVRDQAIGVLQTGPMAIHQVML
    FRQLSDDVTLFLHEGPEPTEQQWEELAARGISVVQGEVEAVETTDDRLTGVRLRGGRVIARQALVVQTSLRARARFLDEL
    GLKAGDREIRGVVIGTAVDAGPGGTTDVPGVWVAGNVTEPMAQVISAAAAGLAAGAGINAELVAEDTRRAVAARSS

    >gi|284032901|ref|YP_003382832.1| alkylhydroperoxidase like protein, AhpD family [Kribbella flavida DSM 17836]
    MSTTTRRRVKVASLAPEFYQAMIALDAQSALGLDPLLAHLVRIRASQLNGCAYCLDMHTLDARHLGESEQRLHLLATWRE
    AGKFFTPKERAALALTESITLVSVDHVPDEVYDAAAEQFDDKELAQLIGLIVTINAWTRIGVTGRLEPGHYSPS

    >gi|284033219|ref|YP_003383150.1| glutaredoxin-like protein [Kribbella flavida DSM 17836]
    MAAFTMYSTPWCGYCHRLKGQLKRAGIEFTEVDIEQVPEAAKLVEKINNGNQTVPTVVFPDGTAMTNPSLAQVAEKLAA

    >gi|284033235|ref|YP_003383166.1| UBA/THIF-type NAD/FAD binding protein [Kribbella flavida DSM 17836]
    MSLPPLVEPADELTIDEVRRYSRHLIIPEVGMAGQKRLKNARVLVIGAGGLGSPALLYLAAAGVGTLGIVEFDTVDESNL
    QRQIIHGQSDVGKSKAQSAKESILETNPNTNVVLHETRLDNDNVFEIFEQYDLIVDGTDNFATRYLVNDAAVLLGKPYVW
    GSIFRFDGQISVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASVGAAQVTEAIKLLTGIGDPSLGRLNIYEALD
    LNWRSLKVRKDPNCAICGENPTVTELIDYESFCGAITEEAADAAAGSTISVKQLSEWIKLKDNGEKDFALIDVREPNEYE
    INRIPGSVLISKADFQTGVALEKLPQDKQLVFH
    CKSGVRSAEVLAIAKGAGFSDAVHVGGGVVAWVDQIDPSQPSY

    >gi|284033318|ref|YP_003383249.1| Carboxymuconolactone decarboxylase [Kribbella flavida DSM 17836]
    MARISLEHRRTVFVRAMEWYSKRKYGDVLDPGKAALHHRGVLTTMLALEGSAARWSRLDPTLKALATMVTSTQVGCSWCM
    DFGFWEFHHRGVAPAKLRAVPGWRDSDVYTDLERAVMDYAESATATPPTVTDEQVERLRKDLSEAELVELTAQIALENYR
    SRTNAALGMTSQGFKQYCEVRPA

    >gi|284033485|ref|YP_003383416.1| protein of unknown function DUF255 [Kribbella flavida DSM 17836]
    MAGNELSTSTSPYLRQHADNPVAWKQWGEAAFAEARERDVPVFLSVGYSACHWCHVMAHESFEDDATAAYLNEHFVCVKV
    DREERPDVDAIYMEATVAMTGHGGWPMSVFLTPAGEPFFCGTYFPLDPRHGMASFRQVLESLVDAWRTKREQIDGIGASV
    VQQLGARQPAVGEAVDAAVLDRAVALLQGDFDPVDGGFGQAPKFPPSMVLDFLLRHHRRTGSEEALAMVTHTCERMARGG
    MYDQLAGGFARYSVDKQWIVPHFEKMLYDNALLLDVYTHWWTVTGSPLAERVALETADFLLAELRTPEGGFASALDADTE
    GEEGRYYVWSPTELRELLGEDADWVIELCDVTGTFEHGTSVLQLRSDPDDLDRWNRIRSVLRDARARRTYPGRDDKVVAA
    WNGLAITALTRAGLVLDRPEYVEAAVKAAELVRDVHVDGSGRLHRTSRDGAVGTAHGVLEDYAAYAQACLTLLAATRDDS
    WLTLAQRLLDRVLQQFVADGTFFDTAADAETLAWRPQDATDNASPAGVSLAAEAFSTLASVTGEARYEQAADQALAASAA
    IAARAPRFAGRALAVAETLQSGPLEIAVIGAEDVAAGDGQEQVTQLVRTALASAPWGTAVVQGKPGSDVPLLAGRGLVDG
    RAAAYVCQKFTCRLPIVLPEDLRGELSTAR

    >gi|284033523|ref|YP_003383454.1| peptide methionine sulfoxide reductase [Kribbella flavida DSM 17836]
    MSFFKRNTALVEPAAALPGRSEPAYSVPADNIVLGTPQTAPAPEGYAEVWFGTGCFWGTEEIFWQQPGVYTTAVGYAGGY
    TPNPSYEEVCTGGTGHTEAVRVVYDPTQTTFTALLKVFWETHDPTQGMRQGNDLGSQYRSAVYYTTDEQRQEVERTRDLY
    APVIAARGYDAITTEIAPASTFYYAEAYHQQYLAKNPNGYRCHSNTGVPFPADEI

    >gi|284033725|ref|YP_003383656.1| methylated-DNA/protein-cysteinemethyltransferase [Kribbella flavida DSM 17836]
    MPYAVIGSPIGDLTLVGSDEGELMGIYMEQHRHRPPMETFGPRDDTILPEVVRQLTEYFDGTRTTFDVPLKLVGTPFQRE
    VWTALTEIPYGTTTTYGELADVLGKTAAASRAVGLANGKNPISIIVP
    CHRVVASTGHLTGYAGGLSRKQALLSLERADAL
    F

    >gi|284033755|ref|YP_003383686.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Kribbella flavida DSM 17836]
    METTEYDLIVLGAGAVGENAADRAVRGGLSAVLVEHELVGGECSYWACMPSKALLRPAQALRAAQAVAGAAQAVTGTLDV
    QAVLERRNSFTSNWKDDGQVEWVEGAGISLVRGHARFSGPKEVTVTDSDGTTTLLRARHAVVVATGSDPVVPDIDGLREA
    NPWTSREATSAKSAPGRLAIIGGGVVAAEMATAYAGFGTEVTLISRGKLLSQQEPFAGEMVADALRDLGATVLVDTNTTR
    VRRTGDEVVVETSDGQTVTADEVLVATGRKPRTEDLGLETIGLTPGDWLPTDDTMRVEGFDWLYAIGDVTKRALLTHQGK
    YQARAAGDVIAARATGSTVSDQPWGVHVATADHEAVPQVTFTDPEVASVGLTDEAARAAGYDVRTVDYEIGNVAGASVRA
    DGYTGKARMVVDEQRKVVLGATFVGPEVSDLLQAATFAVVGQIPLDRLWHAVPAYPTVNEIWLRLLETYGRPTP

    >gi|284033783|ref|YP_003383714.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Kribbella flavida DSM 17836]
    MTHYDLVIVGTGSGNSILDHRFADLKTAIVERGTFGGTCLNVGCIPTKMFVHTADVAATPAHSARFGVDEQLTGVRWADI
    RDRVFGRIDPIAAGGAQYRRQHADNANVTVYDGTGRFTATKELTVTGADGQTRVITADRFVLAAGSRPIVPFVPGLTEAG
    FHTSDTVMRLERLPARLGIIGSGFVAAEFAHVFSSLGVEVTLIARSALLLRREDTEVATRYTDLATAAYDVRLLHETIGA
    VRRDDGSVALTTLSPAGADEVVVDEVLVAVGRQPNSDLLDPAATGVEVDQDGRVVVDAHQQTAVEGIYALGDLSSKYQLK
    HVANHEARVVQHNLLHPDDPIESDHRFVPAAVFGSPQIASVGLTEEQAREQQVPYVVGRAEYAGIAYGWAMENTTGFAKL
    LADPATGLLIGAHLIGPHASTILQPVIQAMSFGLDAHTMARGQYWIHPALPELIENALLNLPLDRS

    >gi|284034198|ref|YP_003384129.1| Redoxin domain protein [Kribbella flavida DSM 17836]
    MRRTAGALAGLVLLLTAACSSGEDTNQNRSGQTGFVSGNGRVSTFGADQRKPAPDFGGETLDGKTWQYADHKGKVVVLNV
    WGSW
    CPPCRKEAPALIAAHKQLGADVQFIGLNTRDLDKAPARKFVQEFGVTFPSLYDPSGKQLLGFRGQISPSSIPSTLV
    IDKQGRVAARVIGEVTTQTLVGMVADAD

    >gi|284034246|ref|YP_003384177.1| glutaredoxin 2 [Kribbella flavida DSM 17836]
    MSAPRVTLYGKPGCHLCEDARAVVEAVCAELGVDWTEIDITQDPELMRAYGEQIPVTLVDGRQHDFWRVDPVRLRKALTR
    T

    >gi|284034308|ref|YP_003384239.1| Carboxymuconolactone decarboxylase [Kribbella flavida DSM 17836]
    MAFIRTAEDGEFFEHNRAPAGHVPNFVRTFAARPAVYDAWKQLNGAIKTSMDLRRYELATLAAATALRSSYCSLAHGQAL
    AEQFFTADEVAGLVVGEPADPVDQAVMAFARKVAVSADRITQADVDRLLALGLSDEDVLDVALAAAARCFFSKTLDATGT
    TPDAAYRSLPQQLREALTVGREIEQP

    >gi|284034539|ref|YP_003384470.1| OsmC family protein [Kribbella flavida DSM 17836]
    MTTETQAQLNGVNLAAVGALVEAIQFDAANARTTWAAHVTWNGAFASESKVRGFQPVPSDEPAALGGTDQAPNPVEQLLG
    ALGN
    CLAVGYAANATVAGIAIDELSIHLKGDIDLRVFLGLAEGHAGFDSITATVRLKSAADPEQLAALHQRVQASSPVGH
    TLTGAVPVTITPA

    >gi|284034698|ref|YP_003384629.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kribbella flavida DSM 17836]
    MHVRAPELKGRGWLNTGGAELRLADFRGRLLLLDFWTFCCINCLHVLDELRPLEEKYGDALVIVGVHSPKFAHEGEEVAV
    KAAVARYEVGHPVLDDPELVTWQNYTARAWPTLVLVDPNGYIVAQYSGEGHAHALDAQLAELIAQHEQAGTLTRGRSPYV
    APEPEPTELRFPAKVIAYDNGFLVADAGNHSVVQLAEDATTVVRRFGTRRRGFQDGPADQSAFSEPNGLTLLPAEVATEV
    GYDVVVADTVNHALRGITLATGETRTLAGTGKQWMDGDGTDVLSSPWDVAWWQDKVWIAMAGVHQLWTFDPFTGATEIAA
    GTTNEGLRDGTPEQAWFAQTSGLAADGDRLWLADSEISALRWIDTEVHTAVGTGLFDFGLRDGKADEALLQHPLGVTVLP
    DGSIAIADTYNGAVRRYDGRQGTVETMATGLAEPSGAVVVGNELLVVESAAHRLTRIRLGASAQADEFSTRTQRPPMEIA
    GGEVTLEVVFTPPPGQKLDGRYGPSTRLLVSATPESLLREGAGDSTDLKRRLVIDERVGDGVLHVAVQAASCDDSAEVEF
    PACHMHRQDWGVPVRVTPDGAARLELVLSGASAS

    >gi|284034919|ref|YP_003384850.1| thioredoxin reductase [Kribbella flavida DSM 17836]
    MNRASMSDPAVRNVIVIGSGPAGYTAAVYAARAQLEPLVFEGSVTAGGALMTTTEVENYPGFSQGIMGPALMDEMRTQAE
    RFGAELVADDVVEVDLTGDVKVVTDSAGAQHRARTVILAMGSGYRKLGLPREEQLSGRGVSW
    CATCDGFFFRQHEIAVVG
    GGDTAIEEATFLTRFADKVTIVHRRDELRASKIMAERAFSNDKIEFAWNSEVAEIHGDDKLTGVTLRDTVTGETRALPVS
    GLFIAIGHDPRSELVKGQVHLDEEGYVLVQPGSTATNLPGVFAAGDLVDHTYRQAITAAGTGCSAALDAERFLATLEHVE
    QSAAATAAATEPVSV

    >gi|284034920|ref|YP_003384851.1| thioredoxin [Kribbella flavida DSM 17836]
    MAEKMNAVTDAEFDQTVLKSDKPVLVDFWAEWCGPCRQVSPILEELAQDHSDKLTFLKMNVDENPVTPSNYRVTGIPTIN
    VYVNGELAKSIVGAKPKAALLKELADFTG

    >gi|284029032|ref|YP_003378963.1| Heavy metal transport/detoxification protein [Kribbella flavida DSM 17836]
    MTTTTYAVSGMTCGHCTSAVTEELTKLPGVQQVRIDLNAGGTSAVHVTSETGLDEAAVREAVDEAGYELAASSPGATA