Kosmotoga olearia TBF 19 5 1 uid59205

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|239616596|ref|YP_002939918.1| methylated-DNA/protein-cysteine methyltransferase [Kosmotoga olearia TBF 19.5.1]
    MATELGVVTTEIGAILLHADYGMLSRIELVFDSKLAPKSLPPFTTQIQEYLEGCRKTFDFPLYLPYAGFKKKVLLYVKEI
    PFGRVVTYGEVAKAAGSPGAARAVGQIMKRNPLPIVIP
    CHRVVSARGIGGFSAGLEWKRFLLELEGVSFDAI

    >gi|239616604|ref|YP_002939926.1| Thioredoxin-related protein-like protein [Kosmotoga olearia TBF 19.5.1]
    MKKIMVLFSVLVIATLSLAYIGKLDDFNVGMKLAKLEKKQLIVMFSDPSCFYCTKFQKETLVNDKVQELLKAGYIFVEIY
    PGEEEATIEVNGKTYNFSYSELYAAFEVRGTPTFWFFDENGTPITNLPGYAPADIFVKVLQYMGEKAYMKGITFDAYTKQ
    NIDYIGESKLIKLTKKEADFVLENDPLARTYTGEFDRYTIWVTENEALASELISKGAFRVILVIE

    >gi|239616634|ref|YP_002939956.1| alkylhydroperoxidase like protein, AhpD family [Kosmotoga olearia TBF 19.5.1]
    MGEIEKFRKFRKKMNKRILETGDINTKRFFSLDSAVYREGALDSKTKELLGLVASMVLRCDDCITYHILQCKSLGVTRDE
    FMEAFNVALVVGGSIVIPHFRRAVALLDELEGED

    >gi|239616713|ref|YP_002940035.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Kosmotoga olearia TBF 19.5.1]
    MAFFDLGSAKQKSEVKDYYDILIIGGGPGGITAGIYAVQAGLDPLIIERALEGGQINNTEKVENWTGFPSISGMDLAEKM
    AEHARAFDVSFLNAEVVELEVEGEKKTVILDNGKKIQSRVLIIATGSNPRKLNVPGEAEFAGKGVSY
    CATCDGHFFAGKH
    IAVIGGGNSALDEALFLSKIVDKITIVQNLPKLTADKLLQERIKATGKVDFIFNTVVDRIEGSDKVERLILKNVETGELS
    TLEVEGVFVFIGLVPNTGFLKGKVKTNDWGYIMTDEHMETNVPGVYAIGDVREKEVRQIVTAAADGAIAVSHASRTYFDE
    E

    >gi|239616714|ref|YP_002940036.1| glutaredoxin-like domain protein [Kosmotoga olearia TBF 19.5.1]
    MSEKLLNDEIRTQVKDILSEMEGKVKLLFFENKDNCDYCSTIEQLLSELTEVTDMVVFEKYDADSEKAKEYSIEISPAIV
    LLTPDGVDKGVRFYGIPSGHEFGTLLQDIISFSKGAKPNLSPESIERLKTIEKPIDIKVFVTPT
    CPYCPRAVITAHNIAM
    ANENVVASMIEANEFPDLSMKFGVSSVPQIVINDEVIFVGAYPEKQFIDEVFKAV

    >gi|239616951|ref|YP_002940273.1| redox-active disulfide protein 2 [Kosmotoga olearia TBF 19.5.1]
    MKIEIYGTGCPKCKQTEKIIRMAVEELEIDAEIVKIEDLMEIMARGISITPAIRIDGEIVLSGKIPSLEEAKKLLQR

    >gi|239617224|ref|YP_002940546.1| Thioredoxin domain protein [Kosmotoga olearia TBF 19.5.1]
    MKEISFSELKNEMNKGLVLIEVFTPTCGVCAAVQRKLQKIEENYPEWKFYSINMLDNPEVSGEFTVFTVPTIIAFHNGKE
    LNRWARNFGIHQITDYLDRLTKMLG

    >gi|239617297|ref|YP_002940619.1| electron transport complex, RnfABCDGE type, E subunit [Kosmotoga olearia TBF 19.5.1]
    MAEKLNKMKVLTNGFIAQNPTYVQVLGMCPTLATTTSAVNGLGMGLATTAVLIMSNVVVSLLRKVIPNKIRIPAYIVIIA
    SFVTVVDLLMHGFVYDLWKTLGLFIPLIVVN
    CIILGRAESFASKNGVFLSFLDGLGMGLGFTGSLVLLGAVREIIGNGSV
    FNVHLTDIKMFAMVLPPGAYIALGLLAGLFNYIGARRNKASKAKAGK

    >gi|239617298|ref|YP_002940620.1| electron transport complex, RnfABCDGE type, A subunit [Kosmotoga olearia TBF 19.5.1]
    MTMGMGTRLFFIFLSAVLVNNFVLSRFLGICPFLGVSRKVDTAIGMSLAVIFVMVMASVITWLLNVLLVALGLPFLTTIV
    FILIIAVLVQFVEIVLKKTSPGLYESLGIYLPLITTN
    CAILGLAVLNVQLEYNLLETIINSVGAGIGFALALIIFSTIRE
    RMDLVELPEAFKGTASALITAGLLSMAFTGFQGLVKL

    >gi|239617339|ref|YP_002940661.1| glutaredoxin-like protein, YruB-family [Kosmotoga olearia TBF 19.5.1]
    MHLKVTVYSTPSCPWCRKAKQYFKSLGIPFKDIDVSKNQKKAEEMYRKSGQMGVPVITIGNQVIVGFDKAKIDKILGI

    >gi|239617467|ref|YP_002940789.1| heavy metal translocating P-type ATPase [Kosmotoga olearia TBF 19.5.1]
    MSKIRKEYIVKGMTCAACVRTVEKLAAKVEGVKNPVVSLASERLIFETDTEINEEKLFQLIKSAGYELEKPQDTRKITLG
    IDGMT
    CASCATAVERSIGKLEGVLSVSVNLTTEKAIIEYDPSRVRISSIKHAVEKAGYTANIMTTQSYDKDRERKETLIR
    SYWNRFLFSSIFTVPLLIIAMGHMLGVKLPSFISPEANPLNFALIQLLLTIPIIIAGKDFYLKGIPNLLRGHPNMDTLVG
    LGTGAAVIYGVFATIQIALGNYYFVGDLYFETAGVIISLISLGKYLENLSKGRTSESIKKLMNLAPKTAFVRKSNGYEEI
    PVEEVEVGDILMVKAGMSIPVDGVVISGNSTVDQSMLTGESIPVDVKEGSKVIGGTVNLSGVIEIKATEVGSDTTLAKII
    KLVEDAQASKAPIARLADIISGYFVPFVLLIAGITFLVWFLLGYGFTFSLTMMISVLVIACPCALGLATPTAIMVGTGRG
    AEMGILFKSGEALEMTHKVNAIVFDKTGTITEGKPKLLDIVPLNGFDKAKVLKLAASMGVKSSHPLDKAVVEAYKGNLHK
    VEDFEAIPGKGIVARVNGKEVKIGSVKFNKSNTRELADIIKKLSDDGKTPVVVTYDGRVIGVLGIADVIKPTSREAIRKL
    KERGTKTFMVTGDNKRTALAIAREVGLDDVMAEVLPENKASVIKKLKSEGYIVGMVGDGINDSPALVEADVGIAIGSGTD
    VAIESADVVLMKDDLNDVVNAIKLSDATIKNIKQNLFWAFFYNIIGIPIAAGVFYMIFGLKLNPMIAGAAMAFSSVSVVM
    NALRLKRVKLD

    >gi|239617468|ref|YP_002940790.1| Heavy metal transport/detoxification protein [Kosmotoga olearia TBF 19.5.1]
    MKVFIDGMTCNHCKIRVEKALAEIEGIKRAVVNLEGGFAVVETEKDIPVEVLKEVIENTGYTFVRIEN

    >gi|239617505|ref|YP_002940827.1| Peroxiredoxin [Kosmotoga olearia TBF 19.5.1]
    MEERIPLIGEKFPELKVQTTHGVMKLPDAFKGKWFILFSHPADFTPVCTTEFVAFQKRYDEFKKLNTELIGLSIDQVFSH
    IKWVEWIKDNLNVEIKFPVIADDTGKVASKLGLIHPGKGTNTVRAVFIVDPEGTIRAILYYPQELGRNVDEILRMIKGFQ
    VSDDKGVAIPANWPNNELIGDEVIIPPASDMETAEKRKEEYQCFDWWFCHKKVD

    >gi|239617507|ref|YP_002940829.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Kosmotoga olearia TBF 19.5.1]
    MKRDVIIIGGGPAGLVTATTAKKTYPDKEILIIRKEKVGLVPCGIPYIFGTIGSVDGNIMGTKPAENLGVEFMTAEVTSV
    DFEAKIVETASGESVQYDKLVFATGSIPVIPKIEGAELSGVYAVPKNKEEIEKVYEAAKKAHNVIIIGGGFIGVEVGDEI
    RKMGKKVTIIEAKPHLLPAAFDESFGKLMEENLKEKNVVVMTETLVTKILGTDKVEGVELSSGEKLSTDMVIFAVGYKPN
    TELVKKLPIHLGYSGSIWVDEYMRTSVKDVFAVGDCAEHKDFFTRKPSKLMLASTAAFDARVAGANLYTLKVVRENHGNL
    GVFSTSVEGLTLGAAGMTYKTACEEGFECVVGEAKSIDRHPGTLPDKSSLYVMLIFSKESGILLGAQIAGGKSVGEMINI
    LGLGLQMGVTANDLVTMQIGTHPLLTSAPTVYPIITAAEAAIRKLRAE

    >gi|239617628|ref|YP_002940950.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kosmotoga olearia TBF 19.5.1]
    MESKAIVGKPVPDFTLENENGESVTLSSFRGKCVVLYFYPKDNTPGCTLEAQDFRDHLKDFEALNTIVLGVSKDSVKSHM
    NFAKKLNLNFHLLSDPEAKVHKIFDVLKPKKRFGKEYIGTERSTFVIDKDGILIKEYRKVKVKGHVQEVLEFIKSNCG

    >gi|239617765|ref|YP_002941087.1| dihydrolipoamide dehydrogenase [Kosmotoga olearia TBF 19.5.1]
    MPKYDVIVVGGGPGGSDCAIRLSQRGKKVAIVERKEFGGTCTNVGCIPTKALLTVAKLYSDIKEKGKRLGVLAQVDIDLK
    TVMKHMNRSILMSRKGTETLLKKYGVEIIKDNVVYKNGSFYLENANEILDTEKIVLATGSKPKIPKTLAVEGIWTSNEVF
    SMSEFPESILIIGAGYIGVEMATIFNAFGTKVILVELQPRIIPFEDIDASIVLEKSLKKRGVKVKTGVAVEKIEKLDNGF
    LTALSDGEQLETEKVLVAIGRAPVYPEGLEDTELVENGKITTNKDFETKWPNVYAIGDVRGAIMLAHVASAEGIALAEKL
    SGKDYDYYSETVPAVIFCEPEIGSTGIKETEDGLSDDYDKFLFPMSANPRANILAERDGFVKLIANKSDHKIVGITIVGP
    NAVELLMEGVVVINEQLTVEELLKSIHPHPTLSEIIRDAAEGLEGNPIHI

    >gi|239618123|ref|YP_002941445.1| OsmC family protein [Kosmotoga olearia TBF 19.5.1]
    MPDMKFKISAVSDNPARVTVNARNFTMIVDEPPQLGGTDQGANPVEYVLAALAGCLNVVGHLVAKEMGIEIRNLSIEISG
    VLDPAKFMGKPTEERAGYKKIDVVMKVDTDADEDTLKKWLETIEQR
    CPVSDNLQNPTPVNITVEASR

    >gi|239617826|ref|YP_002941148.1| OsmC family protein [Kosmotoga olearia TBF 19.5.1]
    MEITMKQVGSMAFYTKTPSGHDVHVDASPKVGGMDSAPRPTELVLIGLAGCTSMDVVSILRKMKVENYTYEIVVSAERAE
    EYPKVFTAIHLKYIFKGKELPHDKIEKAVRLSQERYCSVSAMLGQVAKLTYEVVYEEE