Kocuria rhizophila DC2201 uid59099

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|184199764|ref|YP_001853971.1| putative copper-transporting ATPase [Kocuria rhizophila DC2201]
    MSDPTTSTDTLDSEVHGPLRELELEISGMTCASCVGRIERKLRKIDGVDPAVNLALESATVKVPQDVSDEQIVDTVHRAG
    YEARITGGAQQSAPASQVRGGTGGPAAARGATANPAPGASPAPSGTSPRGTEPEPTGTPRQGGNPVSHATPDQADAPDAT
    AGTTSSPASPDATSVGAVPPDAPERTAGQPEDLEQGPAGNEHRDPALETTPAQRRMNDLKRRFWVAAAFSVPVFVMSMVP
    GAQFPHWGWMAALLALPVVTWAAWPFHRATAVNARHLSTTMDTLVSLGVAAAYLFSLWHLVADPGMTAHAHPGAAMDMSG
    HQLYFESAALVTTFLLLGRWLEARAKSRSGEALKALLDLGAQQATVVAEDGTERTVPVSELRVGDTFAVHPGEKIATDAV
    VLEGESAVDASMLTGESMPLEVGPGDELTGATVNTTGRLLARATHVGSDTVLASMSRTVARAQATKAPVARLADRISSVF
    VPVVMGIALLTLVIWLLVTGDPNRAFVAAVSVLVIACPCALGLATPTAMLTGTGRGAQLGILITSAEVLEDTRSVDSVVM
    DKTGTVTHGEMAVSAVTPLNAWSKDQVLDLAAAVERYSEHPIAHAIVAATPHRYQVTRFESAPGGGVRGYVPDGMNARFV
    VVGRQSWLHENGVRLNTEESDALELARAGGTTTILVAVDGRLAGFIDLRDTVKDEAPAAIAELKDLGLRPILLTGDNAAV
    ARSVAEQVGIDPADVIADVTPDGKVQAIEKLRSEGHVVAMVGDGVNDAPALTTSDLGIAMGSGTDAAMQAADITVVRSEL
    TAVPLAIRLSRRTLSTIKSNLFWAFAYNTVAIPVAALGLLNPMVAGAAMAFSSVFVVLNSLRLRGFAR

    >gi|184200002|ref|YP_001854209.1| hypothetical protein KRH_03560 [Kocuria rhizophila DC2201]
    MAQETGAHEDEQYSTAGHYVHAGEEFTRDTSYIEDRIVADPEHAELAAGARAWPVAPGRYRLIAARACPWANRTLIVRRL
    LGLEDAISVGLPGPTHDSRSWRFDLDPDGRDPVLGTQGLQQNYFARFPDYPRGITVPAIVDVPSGQVVTNDFSQITEDFA
    TEWRAFHREGAPDLWPAELVPEMRPVMKRIYTEINNGVYRCGFAGSQQAYDAAYERLWTALDWVEDRLGTRRYLMGEHIT
    EADVRLFTTLVRFDPVYVSHFKASRNKLTEMPNLWGYARDLFQTPGFGDTVDFQQIKEHYFVVHRDINPSGIVPLGPDLS
    NWTTPHGRESLGGSPFAPGATAPGPVRAEERVDPEHTPLVC

    >gi|184200016|ref|YP_001854223.1| hypothetical protein KRH_03700 [Kocuria rhizophila DC2201]
    MTAARMTTPVRASELEGRAWLNTGGEALDLQSLRGKIVILDFWSFCCINCLHVLDELRPLEEQYADVLVTVGVHSPKFEH
    EADPDALAAAVDRYELTHPVLDDPELRTWDAYTARAWPTLVVVDPEGYIVAHLSGEGHVQGLESLVTELVAEHEAKGTLH
    RGDGPYVPRPQPEGDLRFPGKVVALPDGSFMVSDTGHHRLVQLESDLTTVRRAIGSGARGWSDGPRDVARFNEPQGIAVL
    PGRLRSEVGYDLVVADTVNHRLRGVDLGSGSVRTLAGNGVQRLLDDARARGVDPNEITDTEPTSVALSSPWDVVWSDAAD
    TLVVAMAGTHQLFSFDPRTGALAVLAGTGDEGLRDGSAHESWFAQPSGLAQDAHGDVWVADSESSALRRVRLPGHDAAAP
    GAAAAPAAGSEGIFARAVDALPSGAASTTPSTGAAAPSDGATTPGGVGAPGTGAATVDSAVGLGLFDFGFRDGPAADARL
    QHCLGVTVLPDGSVAVADTYNGAVRRYDPATDEVTTLTRGLAEPSDVLLDTTHEDPVLVVVETNAHRLVRVPVPRQALTV
    DEGAAQVQRKRTQLAPGELELAVRFAAPAGQKLDTRWGDPTQLKVSASPEEALASGGGTAQGLTRTLRLAEGVTEGVLHI
    SARAAACDGSPDGEIPDHAACHLYQQDWGIPFRVDPAAPSELTLDLRGTD

    >gi|184200085|ref|YP_001854292.1| putative molybdopterin synthase sulfurylase MoeB [Kocuria rhizophila DC2201]
    MSAPSPFDPLVEPAAELTREELERYSRHLTLTQFGPVGQRRLKNARVLVVGAGGLGAPALQYLAAAGVGTLGVVDDDVVS
    VSNLQRQVIHTVADVGRPKVDSAADALARLNPLVTVRTHDTRLSTDNALEILGQYDLVLDGADNFATRYLVADAAELTGI
    PVVWGSILRFDGQVSVFWAGRGPVYRDLYPEAPPAGSVPS
    CAEGGVLGVLPATIGSVMATEALKLLTGIGAPLVGRVLVH
    DALAQTWRTLTVLPDPQREPVTDLTQVFVACGLPAPDNDAADRGDVPPAAPGAGAGTPPAAPSAAETVDATELARLLAAR
    ERGETTFTLVDVRDDWERQLVSIPGSVPVPLDRLLADGVQALPAGSEGDVVLHCKAGVRSAQALAALRADYALREDRLKH
    LDGGVLAWIEDVDPTLPRY

    >gi|184200132|ref|YP_001854339.1| hypothetical protein KRH_04860 [Kocuria rhizophila DC2201]
    MVLLTKPGCHLCDDAREVVQRVCAQTGSALREQDITGDEALTRDYAEFVPVVFVDGAAWDRWRIDAERLRSVLE

    >gi|184200134|ref|YP_001854341.1| thiol-disulfide oxidoreductase ResA [Kocuria rhizophila DC2201]
    MSHPTRPLPGAAPVNSLPSSSRRPATRARVRTGVIAVVAAVGLALTGCSSSDDSLAQQANAGGDKGYVAGDGSVSEYAPD
    KRGEPVAFDAAMFDGSTVSAESMRGKPVVLNFWYAG
    CAPCRAEAPDLVALHEEYGDKARFMGVNLRDQKATAEAFERTFG
    VDYPSATDVNGAVLLALSDYVPPQAVPTTLVLDPQGRVAARVLGKADKSTLDALIKDTVAESA

    >gi|184200202|ref|YP_001854409.1| thioredoxin [Kocuria rhizophila DC2201]
    MATVDITQDTLGQTISDNDIVLLDWWAEWCGPCKQFAPTYEAASEKNPEIVFGKVDTESEQGLAAAAQISSIPTLMAFRE
    GILVFSQPGALPASSLDEVITAVKNLDMNEVRAEVEKQAAEAESAAEPEAPQS

    >gi|184200428|ref|YP_001854635.1| selenide, water dikinase [Kocuria rhizophila DC2201]
    MSERTTDSPAQDPAAGLGRLTSYAHGGGCACKIPPGELEDAVRGLTGQNAPDVLVGLDDGDDAAAVLVRPDLAVVSTADF
    FTPVVDSAHDWGRIAAANALSDVYAMGGTPVVAINLVGWPRELLPMELMSEVLQGGLDVAAQAGCPVIGGHSIDAPEPTY
    GMAVTGTADPQRLLRNDAARPGLPITLTKPIGVGLLNNRHKATGEVFPAAIETMTALNRDASRAALAAGVEAATDVTGFG
    LLGHLYKMCRASGVGATIDAAAVPLVEGAADALRDGFVSGGTRRNLDWVRPHLAAGSGVTEDTLLLLSDAQTSGGLLVVG
    EVPGYPVIGETTALPETTDTLVTVR

    >gi|184200440|ref|YP_001854647.1| hypothetical protein KRH_07940 [Kocuria rhizophila DC2201]
    MSVPKIVLFYVFTPLADPEAVKLWQLNLAQRSGVKGRIIVSEQGINATVGGDIHDVKAYVRGLKEYAPFQHADIKWSDGA
    GDDFPRLSVKVRPELVTFDAPDLIRVTEHGVEGGGTHLTPHEVHELVERRGEDVVFFDGRNQLEAEIGRFRGAVVPRTET
    TRDFLRELDSGAYDHLKDKALVTY
    CTGGIRCEVLSGLLRNRGFRDVYQLDGGIVRYGEAYGDRGLWDGSLYVFDERRHME
    FSLSARSLGRCVQCGEATPRYVNCANQQCRRLFLCCETCTGAGARTRCADCVPVAA

    >gi|184200448|ref|YP_001854655.1| thiol peroxidase [Kocuria rhizophila DC2201]
    MTDTAFQGNPVHTVGELPAEGTSVPAFDLVGADLGPVASDEFTGQRMVLNIFPSLDTGVCAQSVREFNKRASELQNTAVL
    CVSKDLPFAQARFCGAEGLDNVVTASAFRSSFGEDYGVTMTDGPLEGLLARAVVVVDENGRVVHTQLVPEITEEPDYDAA
    VAALS

    >gi|184200664|ref|YP_001854871.1| hydroperoxide peroxidase [Kocuria rhizophila DC2201]
    MTSRLSPGDTAPDFTLPDAHGGHLSMADLRGERAVLYFYPRAATPGCTAQACDFRDSLTSLGAAGYRVVGISPDAPEALA
    RFSAEHDLGFPLLSDPDHRVAEAYGAWGEKKNYGKVYEGLIRSTVVLDEHGTVDLAQYNVRAKGHVAKLRRDLGLDS

    >gi|184200729|ref|YP_001854936.1| putative peroxiredoxin [Kocuria rhizophila DC2201]
    MSAIGTPAPEFTLTTKDGGTRSLAEYRGAPLVIVFFPFAFSPVCTDELCHLQDHTDTFEQFGASVVCISADSHYCLDAFA
    RQESYDFELLSDRWPQAEVSRAYGVFDEREGCSLRHTVTVDAEGVIRDVSRAEMTEPREWDRLHDVLADLTRS

    >gi|184200757|ref|YP_001854964.1| DSBA oxidoreductase family protein [Kocuria rhizophila DC2201]
    MSEKQHVDFWFDPLCPWAWMTSRWMEEVVRIRDVDVDWKIISLGILNEDNPDNHHHGHDESMWLVRVIQAAAEQHGGEYY
    KKLYDAMGSRRHPGGMQDLEAIITESLAEVGLPADLAAAKNSTEYDDAIRASTDEARAVAGQDIGTPCIAVNGVGFFGPV
    FTPAPKGEEAGKVWDGALALASYPGFYELKRGREKGPDFS

    >gi|184200804|ref|YP_001855011.1| NrdH-redoxin [Kocuria rhizophila DC2201]
    MSVTVYSKPSCVQCNATYRALTKKGIDYTVVDVTEDTAAYEHVVGLGYQQVPVVETGSEHWSGFRPDKINSLALLLSA

    >gi|184200933|ref|YP_001855140.1| putative iron-sulfur cluster assembly protein IscA [Kocuria rhizophila DC2201]
    MSVTTENETIQDLPAHEVLLTDNAAQKVRDLLEQEGRTDLRLRVAVQPGGCSGLIYQLYFDERVLDGDHVRDFGGVEVIV
    DKMSVPYLSGSTVDFEDTISKQGFSIDNPNAQGSCACGDSFH

    >gi|184201052|ref|YP_001855259.1| putative thiosulfate sulfurtransferase [Kocuria rhizophila DC2201]
    MAAEAEHNEAFAQYAHPERLVSTAWVAEHAGEPGVVVVESDEDVLLYETGHVPGAVKVDWHTELNDTATRDYVDGEAFAA
    LMSAKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHRDVRLMNGGRDKWIAEGRELSTERPEVVASDYPAVERDDTPIRA
    YREDVLAALGTTPLIDVRSPQEYTGERTHMPDYPQEGTLRGGHIPTAASVPWARAAAEDGTFKSRAELEAIYLDEVGLTP
    GEDVIAY
    CRIGERSSHTWFVLTHLLGFENVRNYDGSWTEWGNAVRVPVAQGEERGKAPEATR

    >gi|184201055|ref|YP_001855262.1| peptide methionine sulfoxide reductase MsrB [Kocuria rhizophila DC2201]
    MHVNDDPQRRDTGAPLTPEAAAARTDAQWRELLSSAEYRVLRQAGTEAPHTGEYVDTTTEGVYACRACGAELFRSETKFA
    SHCGWPSFFAPLAEDRVRYIEDTTMGMKRVEVRCATCDSHLGHVFEGEGYDTPTDLRY
    CMNSVSLRLVPVD

    >gi|184201087|ref|YP_001855294.1| dihydrolipoamide dehydrogenase [Kocuria rhizophila DC2201]
    MADNQYDILVLGGGSAGYSAALRAVQLGYSVALIEKEKLGGTCLHWGCIPTKAYLHSAELAEGARESEKYGIKATLESID
    MGAVRDYKNKIVQGKYKGLTGLMKMRKVDVIQGNGKLTGKNTIDVDGTTYTGEHIVLATGSVSKTMGLEIGGRVMTSTEA
    LEIDFVPKSAIVLGGGVIGCEFASMWRSFGVDVTVIEGLPHLVANEDPAIIKTLEREFKKRGIKSNLGTFFEKVEQNDDG
    AKVTLADGKEFEADIVLVAVGRGPNTADMGFEDQGIPMDRGFVTPNERLHTGVGNIYAIGDIVPGVQLAHRGYQQGRFVA
    EEIAGLNPVVVPDINVPKVTFTEPEIASVGYSQPKAEEKFGKDNVETFEYNLAGNGKSSILGTGGLIKLVREKDGPIVGF
    HAIGTRISEQIGEGQLMVNWEAYPEDVAAFVHAHPTQNEAIGEAAMALAGSPLHG

    >gi|184201109|ref|YP_001855316.1| peptide methionine sulfoxide reductase MsrA [Kocuria rhizophila DC2201]
    MPRVVLGMTSSAPQTFVLAGGCFWCLDAVYRRTRGVQRVRSVYTGGHTAHPDYESVCSGTTGHAEAVEVTFDPDVVPAEV
    VLDLFFTGHDPTTLNRQGYDVGTQYRSAMFPADDEQRRTFEAAIARAQELFEDPVVTTVEPLGPLHEAEDFHQDFYGNQP
    FNGYCQVIINPKLAKVRKHYAAWLTD

    >gi|184201149|ref|YP_001855356.1| mycothiol reductase [Kocuria rhizophila DC2201]
    MRSFDLIIVGSGSGNSILTDEYRDLDVAIVEPGRFGGTCLNVGCIPTKMYAYPATVGDQARDAIRLGLDAVIEGVDWPGM
    RDRIFARIDAISKNGLQYRESLDNVTVIQEYVHFVEPKVLETESGQRITADQIVLANGSRVRIPDVPGADLPGVHTSDTV
    MRLDEFPRDVIVVGGGYVAAEFCHVFRGLGASVTQLNRSQRLLREHDDTIAERFTREAAEQWDLQLGWTLSGIERAEDGR
    LTVSAQASDGSSQHWDGTADVVLLATGRVPNADTLRPEAAHLDVTDTGLLAVDEYQRVLSGGEPVSGLWALGDVCSPFQL
    KHVANAEARTVSHNVVHPQELRATDHRYVPSAVFTEPQIASVGMTEDQARDWAARNDERITVKEQDFGDVAYGWAMEDHA
    GICKLIANARTGELLGAHLIGRDSSNLIQPLVQGMSFGLRAHEMARGQYWIHPALAEVVENALLGLDVPGQRAD

    >gi|184201413|ref|YP_001855620.1| hypothetical protein KRH_17670 [Kocuria rhizophila DC2201]
    MSNRLARATSPYLLQHAENPVDWWEFTPEAFAEARERDVPVLLSVGYAACHWCHVMAHESFEDPETGREINEHFVAVKVD
    REQRPDVDSIYMAATQLLTGQGGWPMTVFLTPQGRAFHAGTYYPPRPMQGRPSFRQLLAAVHEAWTARRDEVLRSADQLA
    DALARHPRLVDRMLADAGPSVVTEPGEDAPDAAQRLVGAWLDGLELARDAAHEGFGLGAKFPPSPALEALTRIARPGTAA
    DRQHRAAAPAAAGGATPDTTGSAATDSGGMAPVTTDPATTDSGGTAPATTDSDIPDAAATAAEATGPAPAERETARELLC
    ATLDAMVRGALQDHVGGGFFRYSVTPDWSLPHYEKMLYDNAQLLRVLARTVELLERAGTDTARAARYRHAATALVAWLQR
    EMTTPEGAFAASLDADSDPSPHDPGAEREGAYYTFSRGSAGTGGEDRSAGPGPVTAAWGEAGAVTGILDESLRRTLWDRR
    LERTAPHRDDKVVTAWNGMALTALAEAAVLLEHPQWLESAETAAEFLWQRHRDPEDGTLARTSRGGVVDPHEGRLEDYAF
    LGAGLLALGRATGRGVWYERSVALADTAVARFVRDGTVHDDAALDPTLEAAGATGRAEPFDDVAASGASVLARWIAELSR
    PETGGRPSREITELVTSWATGVVLKAPTAAGGMVSAVLSCTRAPELLEVVDASPGQWREVLDVLGAERVLDTLVLDGAVA
    PYGVPATGTAGFTVWRCRDGRCELPVHSVAELAARSGARRG

    >gi|184201499|ref|YP_001855706.1| DSBA oxidoreductase family protein [Kocuria rhizophila DC2201]
    MASKNNTSGSSSVDARERARQIADRQSRRSNGKPLGLILGVVALVVAIALIIGLVIWQNSKATIPDAGPVPASANQYGGI
    TVTKDGIAQNTSDVKERDLSTLPPAPDEPDTSKTPLGVVDKDKAVGNGKPVQLVIFQDFE
    CVHCADFEKENADALKKAVD
    AGKVEIEYRNLNFLDKATPDQYSSRSANAAYLVAEQVTPDQYMEYSQEVFSHQGSGGLSNKQLAEIAGKHGATVSEKDLD
    ENTYRPMVNVATRESVTNGVAGTPSIFVDGKRYEKGAFEDMLKQAIDAKAKKK

    >gi|184201588|ref|YP_001855795.1| hypothetical protein KRH_19420 [Kocuria rhizophila DC2201]
    MDTVNNLPSATVDEIPEGAPVLDVREQNEWDAGHIEGAQHLPLSQLAERAEEVPLDQDVYVICRSGGRSLRATAYLAQYG
    YDPVNVLGGMGAWADAGKPIVSETGETARVL

    >gi|184201834|ref|YP_001856041.1| 3-mercaptopyruvate sulfurtransferase [Kocuria rhizophila DC2201]
    MTPQWLAEHRDEVVLADARMYLDGRNAEAEYLQGHLRGAVFVDVGADLAEHGRPEGGRHPLPTPEHFAAAMSRAGIGDST
    TVVAYDDAGGVMAARLVWMLRTTGHRAALLDGGLDAFPTDERERHRTVLPTAEFTPAPWPREALATIDEATHGPVVVDAR
    DRTRFAGHTPDPVDPRSGHIPGAVNVPCREHLREDRTLQPVEALRERFEAAGVTDASRMISY
    CGSGVTACHNLLVAEHAG
    LGNGRLFPGSWSQYSHTDRPVETSPTS

    >gi|184201838|ref|YP_001856045.1| putative oxidoreductase [Kocuria rhizophila DC2201]
    MTTANQSTPETGTSAEDVADVVVIGGGPAGENVAQYAHEGGLSAVIVEEALMGGDCSYYACMPSKALLRPVEVARTAAHL
    DGVDSPAVRVRELLARRDAWVSHYDDAGQVRWAEGAGLRVVRGHGEITGPRTVRVTGPDGERTLAARRAVVIATGSVEVV
    PPALEGLHAWSSKDATGVVEVPPRLAIVGGGVVAVEAATWLAALGSSVTLLVRGDALLAKNEPFVGELVRAGLEDAGVDV
    RLNTTVETAHREDARDTGLGRIHGGTVRLRTTGDPLEVDEVLVATGRTPRLTDLGLESVGGTPEDAHAGRLPDWLHLIGD
    AAGTALLTHWGKYEARVLGSRLAGRHETAPDGPVPVPQAVFTDPPVGAVGMTEAEAREAGHGVVVAEAPITGAAGAALLR
    DDAAGRATLVVDEDSGCLLGATFVGPEATELVHGATIAIVGRVPVKLLRHAVPSYPTVSEIWLRLLESLPVALR

    >gi|184201896|ref|YP_001856103.1| putative methyltransferase [Kocuria rhizophila DC2201]
    MTHTVETIDTPDGPFTAVAGPDGTVLASGWTASPEEALARVRAEWRPRDVRTGPVAAMDAVRAFYAGELDPVMAVPVEVH
    GTNGQLAGWEQLRRIRPGDPLTYTEFAEALGTPRAVRAAASVCARNPVALFVP
    CHRVLRGDGSMGGFAWGEDVKRSLLER
    EAAGRAR

    >gi|184201900|ref|YP_001856107.1| organic hydroperoxide resistance protein [Kocuria rhizophila DC2201]
    MDALYTAEALAQGAGRNGSVALKDGSLQFDLAIPKEMGGSGNGANPEQLFAAGYAACFHSALQMVARQQKVSLGDSAVGA
    RVQIGNNEEGGFGLAVQLEVVVPGLEHDKAQELADAAHQV
    CPYSNATRGNIEVTVTVVDE

    >gi|184201954|ref|YP_001856161.1| hypothetical protein KRH_23080 [Kocuria rhizophila DC2201]
    MILSGLVLGAVLGIVMQRGRFCVTGMLRDIFLQRSWRTFTALLVVITVHAVGLAALTTLGVISPDYPSFMPLAVVVGGFM
    FGVGIILAGG
    CASGTWYRSGEGLVGSWIALAMYALSASAMKTGVLKDFNSGMKQWDTGLTTIPSALGVSPWLFVIVLAAV
    TGVMVRHFLNREKNTVNPARLNGRPAWKKPLHVYTAGALVGLIGVIAWPLSAATGRNDGLGITTPTANLLNFLVTGADGK
    LDWGVMLVLGILVGSFIAAKSTGEFRVRVPDATTTVRSIAGGLLMGVGAALAGG
    CTVGNGMVQTSLFTFQGWIALLFIAL
    GVAVATKIWLKPTVTQPATGEDGTYSTAQSLDHTVDATAPDDNSIDAAPTAGAPRTAGANVFSGFAAAPTALMVKDPAGA
    PSKKLTGLGDGYYALDSLGAVCPFPLIEAKDVMQTLQTGDHLVIDFDCTQATEAIPQWAATDGHEVTDFVEKGDASWQIT
    LKKG

    >gi|184201993|ref|YP_001856200.1| thioredoxin reductase [Kocuria rhizophila DC2201]
    MHDVVIVGSGPAGYTAAIYTARANLKPVVLAGSVTAGGELMNTTEVENYPGFIDGIMGPELMDNMQQQAERFGADIRYED
    VVSVELEGEVKTVTLEDGTVLRARAVIISTGSEYRKLGLEDEERLSGHGVSW
    CATCDGFFFKGQDIAVVGGGDSAIEEAT
    FLTKFADKVTLIHRRDQFRASDIMKQRALDDPKIEILWNTRVTGIRGENKVESLALEDTVTGESSELAVTGLFVAIGSDP
    RVGLVKDQLELTVDNTIAVDGRSSTTSLPGVFAAGDVVDPTYRQAITAAGSGCVAAVDVEHYLAALDS

    >gi|184201994|ref|YP_001856201.1| thioredoxin [Kocuria rhizophila DC2201]
    MSAAKDVTDATFQAEVLENSKPTIVDFWAEWCGPCRQLGPVLDALAAEHAEQVDVVKVNVDDNPAIASQYGITSIPAVYL
    FANGEVAKTSIGAKPKSALEKEFAEYLTPSA