Anaerococcus prevotii DSM 20548 uid59219

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257065567|ref|YP_003151823.1| alkyl hydroperoxide reductase, F subunit [Anaerococcus prevotii DSM 20548]
    MLDQNLKNQLAQYLDLLKTEVVIGLSVDDGENSKKLKGFIDDVASLSDKIKVEEKKLKYTPSFELKGDFDHGEIVFAGLP
    LGHEFASFALALLQVGGVSPKLDDKSKARIEALDGKMDFETIVSLS
    CHNCPDVVQAFNIMAILNPNINHTMIEGGMFKDL
    AESRDVLAVPAIFKDGDFFEGGKQSMDKILDLLGSVKDTSHFENKDIFDVLIVGGGPAAATSAIYAARKGLRTGLVASEF
    GGQVNETLAIENIPGFKYTEGPDFMNQMKDQVQALGVDIMTGALAKAIKRNDKDKLIEMSLDNDISLQAKTAILATGARW
    RLIGIPGETEFRNKGVAY
    CTHCDGPLFKDKPVAVIGGGNSGVEAAIDLANLAKKVTVIEFLPELKADKILQDKLKSLGNV
    EIITNAQTTGLYGDGKVQSLKFTDRSSGEEKEIAIDGCFIQVGLVPNTEWLTESEVQLNKHGEIITDKNGASNVEGIFAA
    GDATETAFKQIVIAAGSGATAALGAFNYLMVN

    >gi|257065568|ref|YP_003151824.1| peroxiredoxin [Anaerococcus prevotii DSM 20548]
    MAFIGRKLPEFSLDAYDPSKEEFVTVTDKDLLDKWTVLIFYPADFTFVCPTELEDMQESYKELKELGAEVYSVSVDTHFV
    HKAWHDNSEAISKIEYTMIGDSNKNLTRELDLLDDSGKALRATLVVDPENIIQTIEINADGIGRKANVNINKIKAAKYVA
    SHPGEACPAKWESEEDATLTPGLDLVGKI

    >gi|257065608|ref|YP_003151864.1| Redoxin domain protein [Anaerococcus prevotii DSM 20548]
    MKNKIIFALILALGLTSCGNSPQKADDKAKDMAETKQEEVKKDEKDDKKDADMKEEAVKADDKEKTESVDASKAGNKMLP
    DFTSKDQDGNPYSKEDIAKNDATVINLWFTG
    CSACVEEMDDLNEYSQKLKEQEGVDFVSMCTDVNYDDSTKEAFERIMKD
    KKPTYKNLAVDYEGEMKDFLENIFVYPTTIVVDKNGNVIGDPVEGALNIPEQQEKLQKNIDAAIESSKMAK

    >gi|257065651|ref|YP_003151907.1| methylated-DNA/protein-cysteinemethyltransferase [Anaerococcus prevotii DSM 20548]
    MKYAFYKSRIGILKFSYDKKIESISLVKKSNALSERTPATDKVFGQIEEYLRGERKEFTIYDLLEIMGTDFQKEVIKELR
    NIPYGEKSTYKKVAKNINRKKATRAVANAIGRNPFFIIYP
    CHRVIRSDGKIGGFAYGVEVKRFLLKLES

    >gi|257065798|ref|YP_003152054.1| Glutathione peroxidase [Anaerococcus prevotii DSM 20548]
    MTSVYDFTVLDKDNKEISLSKYEGKVLLIVNTATHCGFTKQYDALEALYKKYKDQGFEILDFPCNQFGNQAPESDEEIDS
    FCALNFGTSFDRFKKIDVNGENEDPLYTFLKEEKKGLGKAIKWNFTKFLIDREGNVVARFGSNKKPENMEKDIEKLLG

    >gi|257065882|ref|YP_003152138.1| selenide, water dikinase [Anaerococcus prevotii DSM 20548]
    MKNLEVCGGCNAKIAAGNLDKLLKDITPYRRHDVLVGFDKNDDAAIIDIDGETCVIQTLDFFPTMVEDPYLFGQIAAANA
    LSDVYAMGGEVISALNIVTFPLEEDFAILKEILRGGNDKVSEAKASLTGGHSIHDKTIKYGLSVTGKVKKKEIRENNTPK
    DGDVILLTKKIGTGLVTANFAQGLVSDEDFEACTRQMATLNKYARDIFVKYQIHAATDITGFGLLGHLSEMAGNDFTIIL
    ESAKVPVLSPAKKLAAEFLYTSGGQNNRNYLEGDVEFMIDDFAMEEVLFDPQTSGGLCISVSPEEADKIITDFRENNLEI
    YQIGQVKRKRSYKIIVK

    >gi|257065964|ref|YP_003152220.1| Redoxin domain protein [Anaerococcus prevotii DSM 20548]
    MTITFAGDKVTLLGTQVKKGDKAPAFKATKNDLSEFNSEDLKGKVVVYSVAPSLDTDVCALQAKKFNKDALELSDDVAIV
    TITEDLPFAQARFCSNEDIKNLEMVSDYKEREFGDKYGFLIDELKLLTRGIVVVDKEGVIQYVEYVPEVTNEVNFEAALE
    EVKKLV

    >gi|257066010|ref|YP_003152266.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anaerococcus prevotii DSM 20548]
    MTIQVNQEAIDFTLKDQFKEDVKLSELKGKKVILSWHPLAYTSVCTDQMRSLERNYERIQEKGDTVVIGLSVDPFPAKAK
    WADILDLKDLKIVSDFFPYAEVTKAYGLFNEENGASKRANVIIDEEGKVKWVKVYGGSELPDIEEVIDNL

    >gi|257066067|ref|YP_003152323.1| peptide methionine sulfoxide reductase [Anaerococcus prevotii DSM 20548]
    MKQTIYLAGGCFWGVDAYFKQLEGVEKTQAGYANGLTEDTFYENLKNSDHAETVKVTYEDEEISLEKLLEYFYYIIDPFS
    INKQGGDLGRQYRTGIYSEDRKILEEVRKFLEEKQKNEEEKIQVEVEKLKNYIKAEEYHQDYLKKNPNGYCHVNLLDRPD
    FN

    >gi|257066257|ref|YP_003152513.1| thioredoxin reductase [Anaerococcus prevotii DSM 20548]
    MYDIIIIGGGPAGLTAGLYAGRSKLKTLIIEKAVAGGQISGTAFVENYPGSIDEATGMGLSERMLEQAEEFCEIKYEDVK
    EVELDGKVKKIKTDGGEYEAKVVIISSGATHRKLDVPGEKEFANKGVSY
    CATCDGPFYTGLDIFVVGGGDSALEEATYLT
    KFAKSVTIIHRRDEFRASGVVVDKIKENPKIKLELDAVVKEIKGDKEAESLIIENTKTGEKKELKSDDNSPIGVFIFIGY
    IPQTEIFEGKIEMNHGYILTDEDMKTNIEGVFAVGDTREKKVRQMVTAAGDGCIAAVLANRYLEGSNW

    >gi|257066480|ref|YP_003152736.1| heavy metal translocating P-type ATPase [Anaerococcus prevotii DSM 20548]
    MKERFDISGMTCASCQANVQKAVQKLGVNDVNVNLISESMIVDYDSDKINNDDIIKAVEKIGYGASLKDKDRSNDVTLKE
    SEEMSTISRLKISFLFLIPLMYISMGPMINLPIPGFLEGRTGAVNNAFVQFLLALPVIFVNRKFFVSGFKGLVNKAPNMD
    TLVALGASAATIFGIFAIMRMSYALGINDNQVLDHYRHNIYFESSATILTLITLGKYFEARSKGETKSSLKHLMELAPKT
    ARVIKDGKEFEVSIEDIKIGDTIIVRPGEAIPVDGVVTKGSSLVDQSAITGESIPVNKNPGDEVISASINKQGSFQFRAK
    RVGENTTISQIISLVNEANETKAPIARLADKIAAIFVPVVIVIAILTFAIWAYITKDFEFALNLMIAVLVISCPCALGLA
    TPMAIMVATGKSAELGLLFKNAESLENLHKIDSILLDKTGTITEGKPVVTDVYTKMDEAEFISIARSIEEASEHPLSNSI
    VEYANDENISPREITDFHSITGMGLEAKIDGKIYYAGNIRLMNEKNISVEGFEDKSIAYSEEGKTSMYFANENKVLGLIA
    VQDLAKDSSIKAIEKLKAMGYHIIMLTGDNEKTAEAIRKKLDIDEKYAEVLPQDKDKVVRKLQESGKKVAMVGDGINDAP
    ALARSDIGIAIGSGTDIAIDSADVVLIKNSLLDIVNSIRLSSKTIKIIKENLFWAFFYNIILIPVAAGILYPRYGVTLNP
    MFAALAMSISSVFVCLNSLRLRNFKPEEESEESKEENKLIKENKMSELNKMIVKVDGMS
    CQNCAKHVTEALEAVAGIKQV
    NVDLENKEANVEFFGSVDENEISKAISEAGYEYKGIEYK

    >gi|257066550|ref|YP_003152806.1| arsenate reductase and related [Anaerococcus prevotii DSM 20548]
    MKLICYKRCTTCKGVEKMLDEKNISYELRDIKDENPTRDELKSWHEKTDYDIKRFFNTSGKIYREENLKDKLKEMTLDEK
    YDLLATDGMLVKRPILFTDDGKILVGPDVKKYVETL

    >gi|257066621|ref|YP_003152877.1| Redoxin domain protein [Anaerococcus prevotii DSM 20548]
    MSRKIKFGSVDVSVDGEKLKVGDKAPDFLAIDKDLNEYSSKEDDGKIKLISVIPSIDTSVCEIQTTMFSKAKEGLSDEVS
    LITISNDLPFAQARFLEEKEMTNNKFVSDYIHHDFSKKYSTLINELKLLNRSVFVIDKDNKIAYAEYLEQNTDLPDYEKA
    IEVVKSLEN

    >gi|257066727|ref|YP_003152983.1| Rhodanese domain protein [Anaerococcus prevotii DSM 20548]
    MYSKIISGKDLEENLENFDIIDVRTEEEYKLGHVEGAINIPYDEILENLDRIDKDKPTIVYCRSNARAEIASLSLKSAGF
    PYIYIGDGVDLYDYKLVK

    >gi|257066811|ref|YP_003153067.1| electron transport complex, RnfABCDGE type, A subunit [Anaerococcus prevotii DSM 20548]
    MGNLFSIIIATIFVSNYVLGQFLGICPALGVTSKVETARGMGMAVIFVITLASIITWIIQYYILDPLNIGFLQTVVFILV
    IASLVQSVETVMKKSMPALYGALGVFLPLITTN
    CVVLGVAIKAIDSSYTLVETIVYALAAAIGFTLAITILAYIRERIEY
    NSLPETFKGVPITLVTLGLMAIAFMGFAGLA

    >gi|257066812|ref|YP_003153068.1| electron transport complex, RnfABCDGE type, E subunit [Anaerococcus prevotii DSM 20548]
    MENQIDRPIENKKEKKAPKENLGKVFIEGIFANNPVFVQTVGMCSVLAISSSLINAIGMGVSVIFVVVMSNLVISLLRNF
    ISDEIRIPAFIVIIAGFVTMVQMAIKAYLPALDESLGIFIPLIVVN
    CLILARAEGFASSHGPVASIVDGLGQGLGYTFAI
    SLLAFFRELLGAGTLFGAQIIPEAYTIGFLQQPASSFIVLGMLVAAFNAISKKRK

    >gi|257066859|ref|YP_003153115.1| hydrogenase large subunit domain protein [Anaerococcus prevotii DSM 20548]
    MKESYIDILNIRRMAFEAVAKIAYENRPITDIALEVFDILPGEEARYRENIFRERAVMGERLRMCIGLDARSAADTDAVT
    EGLDAMDYDRRIYNPPLVSVIKIACEACPENKVTVTDQCHA
    CIGHPCVNVCPKNAVTYTAKGAIIDQDKCIKCGKCVAAC
    PYQAINHQKRPCAESCGVKAIGSDELGRAKIDEDKCVACGRCIITCPFGAISDKSEIYQLIKSLQSDRKVYAIIAPSFVG
    QFGVNVSPEQIREAIKQLGFDDVIEVGLGADLTTMNEAHEYLEQVPTGKIPFMGTSCCFSWKLMVRNQFPDINDKISESS
    TPMIYSGKQMKKRDPNCEVVFIGPCISKKLEALEEEVAEVIDFVITYEELLGMFLAKGIEPSEIEVDEPMMDASETGRFY
    AVSGGVAEAVKRRVGEIDPDAKVEVENAEGLDNCVKLARMAKLGRMDGKLIEGMACMGGCVGGPGTVVAENKTGKKVKAF
    AAESIYRSPADNENIPVEDRPDDSKLQK

    >gi|257066875|ref|YP_003153131.1| glutaredoxin [Anaerococcus prevotii DSM 20548]
    MKDYKLFVGTVCPYCKKVENFMKEENIELEVVNINEDRDALNELVEKGGKRQIPCLYHDGEYLYESDDIIEFLKANK

    >gi|257066897|ref|YP_003153153.1| Heavy metal transport/detoxification protein [Anaerococcus prevotii DSM 20548]
    MKKKFKIQGLQCANCGNKIEGEIKKLDGVIDANVSFLTEKAKIELEDDANVDEILEKANEIAGRIEPGCQFIAK

    >gi|257066989|ref|YP_003153245.1| methionine-R-sulfoxide reductase [Anaerococcus prevotii DSM 20548]
    MNYDKKDLKNKLSDISYRVTQENATERPFSSIYDDFYEEGIYVDIVSGKALFSSLDKYDADCGWPSFTKAIDEGEIKEEV
    DLSHGMVRKEVRSKSADSHLGHVFPDGPKDKGGLRF
    CINGASLRFIPKEKMEEEGYCEYLKLFN

    >gi|257066994|ref|YP_003153250.1| glutaredoxin [Anaerococcus prevotii DSM 20548]
    MADIKIYTSNTCVFCKAAKQYFNEKGIEFTELNVDKDKDAVDYLVSKGYRGVPVINIDGEDIVGFDKEAIEAKLNI

    >gi|257067161|ref|YP_003153417.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Anaerococcus prevotii DSM 20548]
    MKVVIVGAVAAGATFAASLRRLNEDVEIVMFEKDRDLSFGNCEIPYYLSHDIENSSSLVNRTPESFARGYNIRAERFHQV
    ISINREEKYVDVLDKLNNKKFKETYDYLILAPGTKENRPSSITGYEYDHVFSVKNVVDVEKIREYIEKNEVKEVFVAGGG
    FVAIEAAESLHKLDGLNISMLIRKNTSLLSIIDMDLKGFIKDNIRDNDINIIEGKSLVEIGKDYVRFDDDSKNKADLVIL
    ALGARPFSDLAEKAGLDLEDDGSIMVDDNFRTSDEAIFAIGDVINSRNFLTKKKTKLNLAWPAHRQAKYLAKYLLGKRAT
    PPEFIGTFALRSFDLNIAMTGLNEKSLADSGIAYKTCLTAHRDSVGIMPNSKAIYLKLLFDDKDGRIYGAQGLGYGVVDK
    RIDVIASMIKQKATIYDLYDLELAYQPLHSTVEDATNVLANQAINVFEGRLKVVKIDELIESYKDYRIYDLRDKASYEKG
    HIKGVISLAGKDLRKDHNFLPKDEKIIFYDANGGKSSNTVKMLAHYGFDNIYILDGSFVYFEKYDKMMDSSMIEK

    >gi|257067203|ref|YP_003153459.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anaerococcus prevotii DSM 20548]
    MRYDLAIIGAGPAGLSAALNAKIRNKSVIIFGKDSPKLTKTESIKNYLGFGDIRGSELNQRFKDSLKDYEINFSEERVQT
    VYAMGDYHALMLKSGEMVEALAVIVATGIELTKDLVGEEEYFAKGISY
    CATCDAALYKGKEVVLIGYNEESVEEANFIAE
    IVGKLSFVNMYKEDINLDPAINLIEGEVPLGFRGDNRAEVLEFKSGKKIKADGFFIIKDSSKAQRMVPSVKIKDNHIEVD
    SHMATNIAGLFAAGDVTGSPYQIMRAVGQGQIASLEAVRYITKIKSK

    >gi|257067204|ref|YP_003153460.1| thioredoxin domain protein [Anaerococcus prevotii DSM 20548]
    MKRLNSNEFRSEVENGKGLMLVDFSATWCGPCKMQGPVLEGLEGEYTIFNIDIDESEDIASQYNVNAVPSIMIFKDGVLK
    DTLVGFQSREVIVEKMEKYQ

    >gi|257066576|ref|YP_003152832.1| glutaredoxin [Anaerococcus prevotii DSM 20548]
    MRKEIKREWDFELFFKPDCPFCLKVLNYFKKNDIIKFPSYNIEDVVSGYENQDKLYEVGGKVQVPCMVIDGKAMYESDDI
    IAYAKENFLEKAKENKAKREENK