Klebsiella pneumoniae NTUH K2044 uid59073

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|168998630|ref|YP_001687898.1| hypothetical protein pK2044_00340 [Klebsiella pneumoniae NTUH-K2044]
    MNQPREVVIVGAGPAGVGMAALLRRSAIQDILVVDSHEVGASFMRWPEETRFITPSFFSNPFGQPDLNAMTPDSSLALFC
    GEEHPGGKTYASYLKVVLDEYQIPVMAPARIAKVALLSSGNFILTTEAGEKLETRSLIWATGEFQFPDRLIFPGADI
    CCH
    YGDVTSWKDFRKGEYIVIGGYESAVDAAVNLLENGSSVKMLTRSAPWSANHISDPSLSLSPYTRERLNRVMNHRLFEIYE
    DADVCEVIRMPGPGSSYKVHTTNGRAWATDEVPVLATGFQCGGGARQLAAFFEWNDDGYPVLTDEDCSTLFPGLYLVGPH
    VRHAGNIYCFIYKFRQRFPVVAESITRHLGLSSEGLRDWWILPSEPDCCADDDCAC

    >gi|168998655|ref|YP_001687923.1| hypothetical protein pK2044_00465 [Klebsiella pneumoniae NTUH-K2044]
    MENKQNSKKQTLIHIALVLGGFVAGSVIWGAGSNKMNSNDASNETANKQHIERANSINALAQTANQVNKPAGLVLSEQDK
    ELIGKTAAQYLIDHPENLVEAGKRLEANRDGEKTSDVVNTKDVLLETKFTPNYGPDNADVAVIEFFDYM
    CHFCQQSSPVL
    EKAIAENKNVRTFFKDFTIFADRTPISGMGAKIGLYIFNKYGQEKYYEFHNKLMSEAGRAMKDRKDYTPSNLAALVNGLG
    YKEILDQQGNFLLTVEMRDQLQNVLDANMMLADKLNYSGTPVFIVMNMKNPQNKTTTIMPGAPDFYRLQQAINKAKGN

    >gi|168998658|ref|YP_001687926.1| putative thiol:disulfide interchange protein [Klebsiella pneumoniae NTUH-K2044]
    MESLPLDTITYKAPDEKYVIGVFTDITCGFCQKLHSDLQSYLDKGITIKFIAYPRAGMNSMIARNMASVWCADDKPAALT
    RAMKGDGLPEKQPTKACMDSIQSQFNAGNMFKLSGTPSGLSLKGEPMVFAGLRDPEQMLNSLKTANQKK

    >gi|168998670|ref|YP_001687938.1| heavy metal translocating P-type ATPase [Klebsiella pneumoniae NTUH-K2044]
    MSECASKGCGCTTEPIIQPTAPAPLATGSAQAVYRIENMDCPTEEALIRSKLAGLAGVAGLEFNLMQRTLAVRHELPSLS
    PVEQALKAIGMQAVRMDQASAEQTTKLSIAKMD
    CPTEETLIRNKLGTVAGVADLDFNLMQRTLSVRHANQVLPDVLVALQ
    ALGFEAQVVDTAEVASPSAAPVTTPTNWWPLGISLVTASAAEAVYWLHNGNHWSVVVLALVAVFTGGLSTYKKGWIALKN
    RNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQITI
    GARVRVKPGERIALDGEVLEGRSAVNQAPITGESLPVEKSPGDSVFAGTINESGSFEYRVTALANNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPVVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALASDSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FNALPGRGVQGQINGATYHLGNHRMLEELGQCTPELEQRIAALETAGKTVVMLVGAKGVHGLFAVADTIKDSSKRAIAEL
    HALGINTVMLTGDNPHTAQAIAAQAGIDRAQGNQLPDDKLREVEQLSRNGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDDLRKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGHATMWMAVFADMGAACLLSATA

    >gi|168998817|ref|YP_001688085.1| carboxymuconolactone decarboxylase family protein [Klebsiella pneumoniae NTUH-K2044]
    MTEIPEPLKVYQTIAEFANRQGVLDQKTQELISLAVAVTTRCDGCISIHSQAALKAGASREEIAAALAVAVSLNAGAAVV
    YSSHVMEAINQ

    >gi|238892275|ref|YP_002917009.1| periplasmic protein disulfide isomerase I [Klebsiella pneumoniae NTUH-K2044]
    MKKVWLALAGMILAFSASAAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHV
    EFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKNQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK

    >gi|238892359|ref|YP_002917093.1| soluble pyridine nucleotide transhydrogenase [Klebsiella pneumoniae NTUH-K2044]
    MSHSWDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADSVINQQTHMRQGFYERNHCEILQGNAHFVDEHTLALECHDGTVETVTAEKFVIACGSRPYHPADVDFHH
    PRIYDSDSILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGVDDGVIMHLKSGKKLKADCLLYANGRTGNTDTLALENIGLQTDSRGQLKVNSMYQTALPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEASAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMSVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|238892386|ref|YP_002917120.1| thioredoxin [Klebsiella pneumoniae NTUH-K2044]
    MELNMSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGI
    PTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|238892467|ref|YP_002917201.1| adenylyltransferase [Klebsiella pneumoniae NTUH-K2044]
    MNDHDFMRYSRQLLLEDIAIEGQQKLLASRVLIIGLGGLGSPAALYLAGAGVGTLTLADDDAVHLSNLQRQILFTSADID
    RPKAAAAQTRLSQLNPQIKLVALQQRLSGEALRAEVAKADVVLDCTDNMVTRQAINAACVALDTPLVTASAVGFGGQLMV
    LTPPWTQGCYRCLWPESDEPQRN
    CRTAGIVGPVVGMMGTLQALETIKLLSGMATPRNTLRLFDARTSNWRALALQRSRSC
    PVCGGRHADLV

    >gi|238892600|ref|YP_002917334.1| putative DSBA oxidoreductase [Klebsiella pneumoniae NTUH-K2044]
    MGKASAKKGDILSPRLTCRSLIARIPTMSGHKKYLSVALLSAVLLPAMASAADAPATFTPEQEAKIGKIAADYLVAHPEV
    LLQASQKLQQIQAEQQASAATQAVLKNAAVLTQDKNTPTYGPANGKVTVIEFFDYQ
    CVYCSRLAPVMEQVIKAHPQTRFA
    FKEWPIFGGRWESSLEAAKTGLQIYQQKGADAYLAYHNGIYATGHNEGKLTTADIQQQAKKAGFDAKKAADVEPVLQSIN
    DLAQEIGLSGTPGVIVMPTTGATEASITVFPGLADKASLEAAIKKAGG

    >gi|238892613|ref|YP_002917347.1| thiol:disulfide interchange protein precursor [Klebsiella pneumoniae NTUH-K2044]
    MAYRIITLILLLCSTSATAGLFDAPGRSNFVPADQAFAFDFQQQQHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPALP
    AGEWHEDEFYGKSEIFRQRLTVPVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLSAVRAASNDAQPTAAAPVSSLN
    HRPAFNPPLPVEPRPMEENAVLQAPAMAPPADVPARLPFTALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARA
    LLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGGS
    PGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRLLPKSGPWMSHVKTAFG
    FVILALPVFLLERIFGDQWGLRLWSMLGVAFFSWAFITSLGATRPWMRLVQIILLAAALVSARPLQDWAFGAPAVEQQAH
    LAFTRVSSVAELDQALAQAKGQPVMLDLYADW
    CVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNNPQDVALLRHLQVL
    GLPTILFFNAEGQEQPERRVTGFMDAAAFSAHLRDWQA

    >gi|238892698|ref|YP_002917432.1| methionine sulfoxide reductase A [Klebsiella pneumoniae NTUH-K2044]
    MLKDTLRYNLNDDFCIERPTVSLFDKTHLVAQADALPGRNTPMPVATLHAVNGHSMTNVPAGMEVALFAMGCFWGVERLF
    WQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPQVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIY
    PLTPEQTEAAKGSLARFQAAMNDAHDTRHITTEIATAKPFYYAEDDHQQYLYKNPHGYCGIGGIGVCLPPQA

    >gi|238893010|ref|YP_002917744.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Klebsiella pneumoniae NTUH-K2044]
    MILKCWRSIRRWRSNMQILLANPRGFCAGVDRAISIVENALTLYGAPIYVRHEVVHNRYVVDSLRKRGAIFIEQISEVPD
    GAILIFSAHGVSQAVRNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYNNPQGGMYLVE
    SPEDVLKLEVKNDARLSFMTQTTLSVDDTSDVIDALRARFPKIVGPRKDDICYATTNRQEAVRALAEKADVVLVVGSKNS
    SNSNRLAELAQRMGKAAYLIDDASDIQEAWVKDAACVGVTAGASAPDILVQNVITRLQELGGGEAVPLEGREENIVFEVP
    KELRVDVREVE

    >gi|238893098|ref|YP_002917832.1| dihydrolipoamide dehydrogenase [Klebsiella pneumoniae NTUH-K2044]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKSVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKK

    >gi|238893154|ref|YP_002917888.1| hypothetical protein KP1_1009 [Klebsiella pneumoniae NTUH-K2044]
    MSDDVALPLEFTEAAANKVKHLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV

    >gi|238893219|ref|YP_002917953.1| Na(+)-translocating NADH-quinone reductase chain D [Klebsiella pneumoniae NTUH-K2044]
    MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAFVMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMA
    IIASLVIVVDQLLRAFAYETSKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGS
    GKLFGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE

    >gi|238893220|ref|YP_002917954.1| Na(+)-translocating NADH-quinone reductase subunit E [Klebsiella pneumoniae NTUH-K2044]
    MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGI
    REKMKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL

    >gi|238893246|ref|YP_002917980.1| dihydrolipoamide dehydrogenase [Klebsiella pneumoniae NTUH-K2044]
    MHDKYDVLIIGGGPGGYVAAIRAGQLGLRTVLVEKQHLGGICLNWGCIPTKALLHGAEVAHTITHASQLGISVGEVNVDL
    QKLVQFSRTVSQQLTAGVAYLLKKNGVQVIDGTARLRGKGQITVEDARGEARDYRADHVILATGARPRALPGIAPDGEHI
    WTYFEALRPKLLPKSLLIIGSGAIGVEFASLYNDLGCKVTLVELASQILPVEDAEVSAAVRKSFEKRDIQIHTQTLVTQV
    QLTDTGVRCTLNNTGGEYSQDVERVLLAVGVQPNIEDLGLEALGVELDRGFIKTDAACRTNVFGLYAIGDVAGPPCLAHK
    ASHEGVICVETLAGVEGAHPLDRDYVPGCTYARPQVASLGLTESTALARGRPVRIGKFSYQSNGKALASGETEGFVKTIF
    DAETGELLGAHMVGAQVTEQIQGFGIARHLEATDESLLSMIFAHPTLSEAMHESILAACDQPLHQ

    >gi|238893338|ref|YP_002918072.1| putative thiol-alkyl hydroperoxide reductase [Klebsiella pneumoniae NTUH-K2044]
    MVLVTRQAPDFTAAAVLGNGEIVEKFNFKQHTNGKPTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDQGGIGPVKYAMVADIKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMAASPEGVAKYLTENVSSL

    >gi|238893452|ref|YP_002918186.1| copper-transporting P-type ATPase [Klebsiella pneumoniae NTUH-K2044]
    MSNTIDLTLDGLSCGHCVKRVKESLEQRPDVEQAEVTLTEAHVTGSASAQALIDTVKQAGYGAELSHPKAKPLAESSIPS
    EALTAATPELPAAHDEDDSQQLLINGMS
    CASCVSRVQNALAAVPGVSQARVNLAERTALVMGSASAAELVQAVEKAGYGA
    EAIEDDLQRRERQQETALATMKRFRWQAIVALLVGVPVMVWGMIGDNMMVSDDNRSLWLVIGLVTLAVMVFAGGHFYRSA
    WKSLKNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLT
    PPSARVVTPEGEKDLPLAEVQAGMTLRLTTGDRVPVDGMISQGEAWFDEAMLTGEPVPQQKGDGDAIHAGTVVQDGSVLF
    TASAVGSQTTLARIIRMVRQAQSSKPEIGQLADKISAVFVPAVVVIALISAAIWYFFGPAPQIVYTLVIATTVLIIACPC
    ALGLATPMSIISGVGRAAEYGVLVRDADALQRASELDTLVFDKTGTLTEGKPQVVAVKTFAGVDEHTALRLAAALEQGSS
    HPLARAILDKAADGPLPEVSGFRTLRGLGVSGEAEGHRLLLGNQALLNEQHINTAEVESEMTAQASRGATPVLLAVDGQA
    AALFAIRDPLREDSVDALARLHRQGYRLVMLTGDNPTTAKAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGHKVAMVGDG
    INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLHGVADALAISKATLRNMKQNLLGAFVYNSLGIPIAAGILWPLTG
    TLLNPVVAGAAMALSSITVVSNANRLLRFKPKE

    >gi|238893458|ref|YP_002918192.1| putative thioredoxin protein [Klebsiella pneumoniae NTUH-K2044]
    MSEQNIVNISEANLQQTLQQSMNVPVLFYFWSARSQHCEQLTPVLERLAAQYNGQFTLAKVDCDAEQMLASQFGLRAIPT
    VYLFQNGQPVDGFEGPQPEEAIRALLDKVLPREEELKAQQALALMQEEKYADALPLLKEAWQLSNQESQIGLLLAETLIA
    LHRSDEAESVLKTIPLQDQDTHYQGLVAQIELLKQAADTPQIQQLQQQVEQNPEDAQLASQLALQLHQVGRNEEALALLF
    SHLQKDLGAGDGQARKMLQEILAALGTGDALAAKYRRQLYSLLY

    >gi|238893682|ref|YP_002918416.1| periplasmic disulfide isomerase/thiol-disulphide oxidase [Klebsiella pneumoniae NTUH-K2044]
    MLKRLLLLSLLPLCSHAEELPAPVKAIEKQGITIIKPFEAPGGMKGWLGKYQDMGVAIYLTPDGKHAISGYMYDENGSNL
    SEQLFQKELYTPAGQEMWKKMASAHWLQDGRKDAPIVLYVFADPF
    CPYCKQFWQQSRPWVEAGKVQIRTLLVGVIKPESP
    ATAAAILASNDPAKTWHDYEQSNGKMALTIPKVIPPEKMKMLNVNQQLMDDLGANVTPAIYYMNKDNMLQQVVGLPDKEK
    LHIMMGEKE

    >gi|238893684|ref|YP_002918418.1| alkyl hydroperoxide reductase C22 subunit [Klebsiella pneumoniae NTUH-K2044]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|238893685|ref|YP_002918419.1| alkyl hydroperoxide reductase FAD/NAD(P)-binding subunit [Klebsiella pneumoniae NTUH-K2044]
    MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAVRKPSFLITNPGSDQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFMNGQEFGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEGGLHQIETASGAVLKARSVII
    ATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
    KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA

    >gi|238893885|ref|YP_002918619.1| molybdopterin biosynthesis protein [Klebsiella pneumoniae NTUH-K2044]
    MGRGRTLQSPVWGAVMTVELSDEEMLRYNRQIVLRGFDFDGQERLKAARVLVVGLGGLGCAAAQYLAAAGVGQLTLLDFD
    TVSLSNLQRQTLHSDATLGQPKVDSAREALARINPHVRLVPLNALLDEAALAAQIADHDLVLDCTDNVAIRNQLNVGCFQ
    HKTPQVSGAAIRMEGQISVFTYQDGEPCYRCLSRLFGENALT
    CVEAGVMAPLVGTIGSLQAMEAIKLLSGYGTPASGKIV
    IYDAMTCQFREMRLMRHPQCEVCGSH

    >gi|238893908|ref|YP_002918642.1| glutaredoxin 1 redox coenzyme [Klebsiella pneumoniae NTUH-K2044]
    MFTVIFGRPGCPYCVRAKELAEKLTNERDDFNYRYVDIHAEGISKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLGLFA

    >gi|238893949|ref|YP_002918683.1| thioredoxin reductase [Klebsiella pneumoniae NTUH-K2044]
    MYANYYGDLMGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHE
    HAAKFETEIIFDHISRVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAV
    IGGGNTAVEEALYLSNIASEVHLIHRRDSFRAEKILIKRLMDKVASGNIVLHTDRTLEEVTGDQMGVSGLRLRDTKNSDN
    VESLEVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAE
    RYLDGLADACK

    >gi|238894088|ref|YP_002918822.1| putative DsbA oxidoreductase [Klebsiella pneumoniae NTUH-K2044]
    MDTCKGSTMVVHGKVIKLLITILMVGLSSAAYSKDYQAGKNFTVIHSTVKQPPPLVEFFSFYCGPCYAFAERINVDTAIR
    KRLPDDMKLEKYHVSQMGPLGPALTEAWAVAQYAGVDGKVEKLLFEGLQVKRDIKTAADIVKVFNQLGITSEKYAEMQSN
    FMVKALIARQDNLVEKMKVHGTPSFYVSGKYHINNASLAQDDYDTYAEDMANLVLFLLNKPL

    >gi|238894105|ref|YP_002918839.1| hypothetical protein KP1_2057 [Klebsiella pneumoniae NTUH-K2044]
    MPAVYFLISMSSRYTMPVLHNRISNETLKAQMLAETEPRTTISFYKYFTIVDPQATRDALWVALTQLKVFGRIYLAREGI
    NAQISVPQSNVEALREFLYGFDPALAGLRFNIAVEDDGKSFWVLRLKVRDRIVADGIDDPSFDASNVGEYLKAAEVNAML
    DDPDAVFIDMRNHYEYEVGHFENALEIPADTFRDQLPKAVEMMQDHKDKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIE
    GGIIEYARRAREQGLPVRFIGKNFVFDERMGERISNDVIAHCHQCGAPCDTHTNCLNDGCHLLFIQCPSCAEKFAGCCSE
    ACMEEHKLPEEEQRKLRAGRENGNKIFNKSRGRLNTKLGILDPEPSEKP

    >gi|238894244|ref|YP_002918978.1| putative glutathione peroxidase [Klebsiella pneumoniae NTUH-K2044]
    MNCFYSQEPAMTPFYQLTATRLRGQPLSMADYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVLGFPCNQFGKQ
    EPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGGRIKWNFTKFLIGRDGTPLTRFAPFTTPEKM
    EASIVAALTR

    >gi|238894252|ref|YP_002918986.1| methionine sulfoxide reductase B [Klebsiella pneumoniae NTUH-K2044]
    MANKPTPEELKNGLSEMQFYVTQHHGTEPPFTGRLLHNKKNGVYHCLVCDAPLFNSQTKYDSGCGWPSFYEPVSAEAIRY
    LTDNSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLSFTDEQNGEQIKG

    >gi|238894262|ref|YP_002918996.1| selenophosphate synthetase [Klebsiella pneumoniae NTUH-K2044]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETSDDAAVYDLGNGTSIVSTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIAREVVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RIKKNSTAQAGCKLYLTKPLGIGVLTTAEKKSLLKPEHQGLATETMCQMNLAGAAFAAIDGVKAMTDVTGFGLLGHLSEV
    CRGAGVQAQLRYADIPKLPGVEDYIAAGAVPGGTGRNFASYGHLMGEMPTEWRDLLCDPQTSGGLLLAVTPEAEAEVQAA
    AAEFGIKLAAIGELVTARGGRPMIEIR

    >gi|238894268|ref|YP_002919002.1| putative thiosulfate sulfur transferase [Klebsiella pneumoniae NTUH-K2044]
    MKRVSQLTALALLMGLAASTTCAAETMPALTLFHLQQQHGVAIDTRLSAYYNGWPQRANGPEGHEPQALNLSARWLGAMS
    DDQLRAWAKQHQLQSDTPIALYGSPEDNASVAARLKQTGFTRLSTLSDALSQTDRLQKLPHFEQLVYPQWLHDLQQGKAV
    AAAPAGDWKVFEAAWGAPKLYLLSHIPGAGYIDTNEVESEPLWNKVSDAQLKAMLAKHGIRHDTTVILYGRDVYAAARVA
    QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGMPPAQQPAPDFGAPIPGQPQLMLDTEQARGLLHRQDASLVSVRSWPEFI
    GTTSGYSYIKPKGDIAGARWGHAGSDSTHMEDFHNPDGTMRSADDIAALWRQWNILPSQQVAFY
    CGTGWRASETFMYARA
    MGWPHVAVYDGGWYEWSSNPHNPVARGERGPESSQ

    >gi|238894272|ref|YP_002919006.1| hypothetical protein KP1_2246 [Klebsiella pneumoniae NTUH-K2044]
    MSLPPLDSVPLILRPQAWLHRRHYGQVLSPIRWWGRIPWLFYLVSLFVGYIERRRSPLDPVLRSLVSARIAQLCHCEFCI
    DITSMTLAARSGSQDKLLAVADWRSSTLFSEKERLALAYAEAATQTPPAVDDALRRAMAAHFDARALTELTALIGLQNLS
    ARFNAAMAIPAQGLCQIPTSSSQNKE

    >gi|238894370|ref|YP_002919104.1| thiol peroxidase [Klebsiella pneumoniae NTUH-K2044]
    MSQTVHFQGNPVSVQGTIPQAGAKAQPFTLVAKDLSDVALSQYAGKRKVLNIFPSIDTGVCAASVRKFNQLAAELDNTVV
    LCISADLPFAQSRFCGAEGLSNVVTLSTLRGASFLADYGVAIATGPLAGLAARAVVVIDENDQVVYSQLVNEITEEPDYD
    AALAALKA

    >gi|238894521|ref|YP_002919255.1| paral putative membrane component of transport system [Klebsiella pneumoniae NTUH-K2044]
    MPPLVGHRPLIPSEFRGIFMTWQSFKQAWLIRFWSPVPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLLGVHSE
    QWGYYQLIHLEGSPLTRIDGRMIIGMFGGCLAAALWANNVKLRLPRSRIRIAQAVAGGIIAGFGARLAMG
    CNLAAFFTGI
    PQFSLHAWLFAIATAIGSWFGARFTLLPLFRIPVKMQKVSAASPLTQKPQQARRRFRQGMVVFFAMIGWGLLTAADHPAL
    GLAMLFGIAFGLLIERAQICFTSAFRDMWITGRTVMAKAIIFGMAASAIGIFSYVQLGMAPKIMWAGPNAAIGGLLFGFG
    IVLAGG
    CETGWMYRAVEGQVHYWWVGLGNVIGSTLLAWCWDDIAAPLATHWQKVNLLNAFGPFGGLLATYLLLLIALLLV
    IAWERHFFRRQAAVRTVKESA

    >gi|238894549|ref|YP_002919283.1| O-6-alkylguanine-DNA/cysteine-protein methyltransferase [Klebsiella pneumoniae NTUH-K2044]
    MLTLLQDKMDTPLGPLWVLCDEQFNLRAVEWDEHRDRMETLLDVHYRREGYQRVDCRNPGGLSSKLSDYFAGDLAIIETL
    PTATAGTPFQRQVWQALRDIPCGQVMHYGQLAEALGRPGAARAVGAANGANPVSIVVP
    CHRVIGRNGTMTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|238894643|ref|YP_002919377.1| hypothetical protein KP1_2646 [Klebsiella pneumoniae NTUH-K2044]
    MSVVTQFPPATSAEAIRWFSHKLHLETDCADVHSAQRAGEVDFVLLHVVGSEEAFARRHLPGAQHLPHSQITAERMAAWP
    AETLFVVYCAGPH
    CNGADVAALKLAELGRPVKMMLGGLTGWEDEGYAFVSGK

    >gi|238894839|ref|YP_002919573.1| putative cytochrome c biogenesis protein [Klebsiella pneumoniae NTUH-K2044]
    MSILIAFLGGMLTLLSPCTLPVIPLLFASVRGRRGQLSIMLAGMALMFGAVSWLVTVASGWVVNLTLAGRGLALAFFALV
    GLSLLSQRVAQRLTSPLVTLGNQLNDASSRQRGWIGSLLAGLAVGLLWAPCAGPVLGAVLSLGFVHPGQATTGGLLLAYG
    SGGALMLFLLGWCGAALITRLRRGQAFGERLRRLAGGAMLASVALIASGGDRYLQSAGGLSQALEQRLAARLPQPEQKTS
    LQPIAAPQPSSAMPSLAGGSAWINSPALTPERLKGKVVLVDFWTRE
    CINCQHTLPYVRDWANKYRAAGLVVIGVHTPEYP
    WERSLPLLRQAVKDWRITYPVVADNEYAIWNAFGNQYWPAHYIFDARGQLRYTAFGEGDYARQEQVIQQLLQESKA

    >gi|238894874|ref|YP_002919608.1| osmotically inducible protein [Klebsiella pneumoniae NTUH-K2044]
    MAIHKKGLAHWEGDLKHGKGTVSTESGALSQQPYGFNTRFEGVKGTNPEELIGAAHAACFSMALSLMLSEEGYTATSIDT
    TAVVTLNKTDGGFAITDIALQSQIVLPDVSPAAFDEIIQKAKAG
    CPVSQVLKANITLDYQLNP

    >gi|238894901|ref|YP_002919635.1| hypothetical protein KP1_2923 [Klebsiella pneumoniae NTUH-K2044]
    MTLSQDILAELAEIAPGSPLDQARAVRDAATRHAQGSYEVLFRQQDADFPLDERFAVAAKVAKLHQADALAAHYAGFGLA
    DPTTDRLVPALAFARLLTFTPVEATPGALHTLTSAGWSLRGIVTLAQLVAFVSFQSRLLLGLRALNHKPIVSADTPLVAG
    YWHTTPYAQSGKAAPVRFTRDELHWEPWLADKPLAEFNAEEQAILAKYGHSDSPYFRLLARNQPVLEQRTLTDRGIFYTA
    GGLPRAERELAATVASKINGCIY
    CASVHARKAAQLAKDETAVDTLLAVTPGEDLRDGQSPRWQAEIDAAAALSVTPPALN
    ADHLAALDEQGLDTLAQLDLLQSAAFFAWANRLMLTLGEPWRE

    >gi|238895007|ref|YP_002919741.1| electron transport complex protein [Klebsiella pneumoniae NTUH-K2044]
    MADYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLVYLRTLAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHNFLQSALYGFAAAVGFSLVMVLFAAIRERLVV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|238895012|ref|YP_002919746.1| NADH-ubiquinone oxidoreductase [Klebsiella pneumoniae NTUH-K2044]
    MSEVKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISSLRRWTPAEIRIPIYVMIIASVV
    SVVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPALSALDGFSIGMGATCAMFVLGSLREILGNGTLFDG
    ADSLLGSWAKVLRIEVFHTDTPFLLAMLPPGAFIGLGMMLAIKYLIDERSKQRKAQAARAVSVAPSDVTGKA

    >gi|238895016|ref|YP_002919750.1| glutathionine S-transferase [Klebsiella pneumoniae NTUH-K2044]
    MKLFYKPGACSLASHIALRESGLDFTLQSVDLAQKRLENGEDYLLINPKGQVPALLLDDDILLTEGVAIMQYIADQVPDR
    HLLAPVGSIARYQTLEWLNYVATELHKSFTPLFRPDTPEDYKPVARGLLEKKLQYVDAALADKQWLTGHRFTIADGYLFT
    VLRWAYAIKLDMAAYGHIGSWMTQVAARPAVAAALAAEGLK

    >gi|238895035|ref|YP_002919769.1| hypothetical protein KP1_3065 [Klebsiella pneumoniae NTUH-K2044]
    MSSTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYHTDEPKAE

    >gi|238895111|ref|YP_002919846.1| heme lyase/disulfide oxidoreductase [Klebsiella pneumoniae NTUH-K2044]
    MNRKLLFIPLVLFLALAAALFWQLMRNAEGDDPTTLESALIGKPLPEFRLEALNTPGQTLDRRTLIDGKPLLLNVWATWC
    PT
    CRAEHQFLNGLAQQGVRVVGMNYKDDRQKAMSWLQRLGNPYRLSLYDGNGMLGLDLGVYGAPETFLIDGQGIIRWRHA
    GDLNERVWREELQPLWDQYNRRAG

    >gi|238895163|ref|YP_002919898.1| putative rhodanese-related sulfurtransferase [Klebsiella pneumoniae NTUH-K2044]
    MSTYAYRQAAGIRQALLDRRELALIDVREEADFATAHPLFAVNLPLSKLELEVRRRIPRFTTPLTVYDNGEGLAEIAVER
    LRSWGYQDVALLAEGLAGWRRSGGELFQDVNSASKAFGELVESVRHTPSLSAQEVQALIDSRQEVVIVDARRFDEYQTMS
    IPGSISVPGGELALRVESLTPSPQTPVIVN
    CAGRTRSIIGTQSLINAGVPNPVHALRNGTIGWTLAGQTLAHQQQRQYDP
    SARASGARAAEVAHFAERAGVAVIDEATLQRWLQQSDRTTFLFDVRSPEEYAAGHYPGSLSAPGGQLVQETDHFASVRGA
    RIVLLDDDGIRAAITGSWLAQMGWETARLSALSTSQLSERGVPAAEVPPGPQAEEISPAQLAQQLEEPGTVVLDFTTSAN
    FVARHIPGAWWLTRSQLRQALEAIPPAQRYVVT
    CGSSLLARYAVPEVTALTGKPVQLLTGGTLAWIAAGLPLAHGDSGLA
    VERRDRYRRPYEGTDNSAEAMQAYLEWEYGLVDQLARDGTHGFRVL

    >gi|238895191|ref|YP_002919926.1| iron-sulfur cluster assembly scaffold protein [Klebsiella pneumoniae NTUH-K2044]
    MEVQAGTFNPADFSWQGLTMTPAAAAHIRDLMRKQPDKKGLRLGIKTSGCAGFGYVLEMIAEPAPDDLLFESDGAKLFAP
    LQAMPFIDGTELDYVREGLNEIFKFHNPKAQHECGCGESFGVQAE

    >gi|238895219|ref|YP_002919954.1| hypothetical protein KP1_3267 [Klebsiella pneumoniae NTUH-K2044]
    MTLSFTTHWRDELPDFYTSLSPTPLDNARLIWRNAPLAQQLGVPDALFAPESGVGVWGGEALLPGMSPLAQVYSGHQFGA
    WAGQLGDGRGILLGEQQLADGRRYDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHALGIPTTRALAMVTSDTPVY
    RERVEPGAMLMRVSESHVRFGHFEHFYYRREPQKVQQLADYVIRHHWPQLQDEADKYLLWFRDIVMRTAQTIASWQTVGF
    AHGVMNTDNMSILGLTIDYGPYGFLDDFQPDFICNHSDYQGRYSFENQPAVGLWNLQRLAQSLSPFISAEALNAALDEYQ
    HALLTAYGQRMRDKLGLFSQQKGDNDLLDGLFALMIREKSDYTRTFRLLSHSEQLSAASPLRDEFIDRAAFDSWFAGYRA
    RLRDEQVDDAQRQQRMQGVNPALVLRNWLAQRAIEQAEAGDMGELERLHAALADPFTDREDDYVRRPPDWGKRLEVS
    CSS


    >gi|238895222|ref|YP_002919957.1| vitamin B12 ABC transport system periplasmic component [Klebsiella pneumoniae NTUH-K2044]
    MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSVLGFPCNQFLGQEPGSEEEIK
    TFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVAPEGSGFYERMASKGRAPLYVDDILWNFEKFLIDRQGNVIQ
    RFSPDMTPDDPQLVAAIKGALAQ

    >gi|238895285|ref|YP_002920020.1| putative phosphatase [Klebsiella pneumoniae NTUH-K2044]
    MQRIVIIANGAAYGSESLFNSLRLAIALREQQSDLDLKLFLMSDAVTAGLRGQKPAEGYNVQQMLEILTAQQVPVKLCKT
    CADGRGVSALPLVDGVEVGTLVELAQWTLAADKVLTF

    >gi|238895372|ref|YP_002920107.1| disulfide bond formation protein B [Klebsiella pneumoniae NTUH-K2044]
    MLQYLNQCSRGRGAWLLMALTAFILELVALWFQHVMLLQPCVMCIYERCALFGIMGAGLVGAIAPKTPLRYVAMAIWLYS
    AIRGLQLAWEHTMIQLHPSPFQT
    CDFAARFPTWLPLDKWLPQVFVASGDCSVRQWQFLSLEMPQWLVGIFAAYLLVAILA
    IVAQPFKAKKRDLFGR

    >gi|238895760|ref|YP_002920496.1| O6-methylguanine-DNA methyltransferase/DNA-binding transcriptional dual regulator [Klebsiella pneumoniae NTUH-K2044]
    MKPIVADTDDRRWQAVCERDTRADGQFVFAVLTTGICCRPSCRSRRARRENVRFFADVAAAVAAGFRPCKRCQPDKDYPQ
    QQRVDKVAQACRLLEQDAPLTLDALAGQLAMSPFHFHRLFKSVTGMTPKAWQQAWRAQRLREALEQGIPVTRAALAAGFP
    DSSSYYRQADAALGMTASQFRRGGAATVVTWTTGDCALGRCLVAQSERGVCAVLPGDNDAALIDDLRRRFPNAELREGDP
    DFCQQMAEIFAHLDDSRRPVSLPLDLQGTAFQLQVWQALRQIPAGETRSYRQVAEHIGQPRAVRAVAGACAANSLAVIVP
    CHRVVREDGALSGYRWGTARKAQLLAREAQHEEE

    >gi|238895930|ref|YP_002920666.1| conserved thioredoxin-like protein [Klebsiella pneumoniae NTUH-K2044]
    MLTMYGIKNCDTIKKARRWLEAHQIEYRFHDYRADGLERAQLDTFIAELGWQALLNTRGTTWRKLDESLRNSIDNADAAA
    ALMLEMPAIIKRPLLCAPGRPMLLGFSEASYQQFNEV

    >gi|238895940|ref|YP_002920676.1| bacterioferritin comigratory protein [Klebsiella pneumoniae NTUH-K2044]
    MTPLKAGDIAPKFSLPDQDGEEVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKENA

    >gi|238895944|ref|YP_002920680.1| putative arsenate reductase [Klebsiella pneumoniae NTUH-K2044]
    MTDAVKIYHNPRCSKSRETLSLLQSRGIDPEVVLYLETPPDAGTLRQLLQLLGMESPRELMRQKEELYKSLNLADPALSN
    AALIQAMVDNPKLIERPIVVSRGQARIGRPPEQVLEIVS

    >gi|238895977|ref|YP_002920713.1| 3-mercaptopyruvate sulfurtransferase [Klebsiella pneumoniae NTUH-K2044]
    MSTSFFVAADWLAEHIDDPEIQIIDARMAPAGQEALRDMAAEYRAGHVPNALFFDIEALSDHTSPLPHMMPRAEAFAVAM
    RELGVCSDKHLVVYDEGNLFSAPRAWWMLRTFGVEKVSILAGGLEGWRRDELPLEQGMPEVAEGEFDVRFDPQQIKRLTD
    VLLVSHEGSAQIVDARPAARFNGQADEPRPGLRRGHIPGALNVPWTDLVINGELKTVDELNDIFLRQGVDFERPIIAS
    CG
    SGVTAAVVVLALTTLGVNGVCLYDGSWSEWGARSDLPIEPAPAAP

    >gi|238895985|ref|YP_002920721.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae NTUH-K2044]
    MSITLSDSAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPAAEDTVFEDKGVKVVIDGKSLQFLDGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFNV

    >gi|238896031|ref|YP_002920767.1| putative thioredoxin-like protein [Klebsiella pneumoniae NTUH-K2044]
    MNTVCASCQALNRLPDDRSADGAKCGRCGHDLFDGDVINATGATLDKLLKDDLPVVVDFWAPWCGPCRSFAPIFEDVAEE
    RSGKMRFVKVNTEAERELSARFRIRSIPTIMMFKNGEVIDMLNGAVPKAPFDSWLNEAGQQ

    >gi|238896118|ref|YP_002920854.1| putative phosphatase [Klebsiella pneumoniae NTUH-K2044]
    MTIATLTPAEAQAQIAQGARLIDIRDADEYAREHIPDAELVPLATLTSGAPLNARAGETVIFHCQAGSRTQNNAIRLAAA
    AAPAQPCLLAGGIQAWKAAGLPVVEDSSQPLPLMRQVQIAAGVLILLGVLLGYTVNGGFFLLSGAVGAGLTFAGVTGFCG
    MARLLATMPWNRRQGVKTRSR

    >gi|238896127|ref|YP_002920863.1| hypothetical protein KP1_4266 [Klebsiella pneumoniae NTUH-K2044]
    MNQLRQPFSELSPEVYKGLVQASIALEKSELGNALVELVYLRVSQINGCAFCLEKHSQALRKGGMAQSKLDALAGWRVSA
    HFTPAERAALAWAESVTDIATSHAEDEVYQPLREHFTPRQISDLTFAVSLMNAFNRLAVAMRL

    >gi|238896128|ref|YP_002920864.1| glutaredoxin-like protein [Klebsiella pneumoniae NTUH-K2044]
    MRIIIYTRNDCVQCHATRRAMESRGLAFEMVNVDQQPDAADTLREQGFRQLPVVIAGELRWSGFRPDMINRLRPSFTAAS
    A

    >gi|238896206|ref|YP_002920942.1| hypothetical protein KP1_4355 [Klebsiella pneumoniae NTUH-K2044]
    MFTICPFRLSETTMNSKAAITITYCSQCNWMLRASWMAQELLHTFSTDIASVTLVPGTGGIFTIDVDGQQIWERKQDGGF
    PDAAELKRRVRDVCFPEKPLGHVDKGDQKG

    >gi|238896415|ref|YP_002921153.1| arsenate reductase [Klebsiella pneumoniae NTUH-K2044]
    MSITIYHNPDCGTSRNTLALIRNSGAEPTVIYYLETPPSGDELRQLLAAMGIPVRALLRKNVEPYDALGLAEDRFTDDQI
    IDFMLQHPILINRPIVTTPQGTRLCRPSEVVLEILTAPQQGAFVKEDGEPVIDAAGQRVK

    >gi|238896433|ref|YP_002921171.1| protein disulfide isomerase II [Klebsiella pneumoniae NTUH-K2044]
    MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYVTDDGKHIIQGPMYDVSGAQP
    VNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDIT
    CGYCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAI
    WCAKDRNKALDDAMNGKGVQPASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN

    >gi|238896444|ref|YP_002921182.1| copper-sensitivity suppressor protein B [Klebsiella pneumoniae NTUH-K2044]
    MYMVFRRLLVCLLWLWLPVSQAADSGWLRAADNQHASVRLRAQTESNGDTRLLLDVALEKGWKTYWRSPGEGGIAPAIAW
    HTPLEVNWRWPTPQRFDVAGISTQGYHGDVSFPMTLRGKIPPTLSGVLTLSTCSNVCILTDYPFSLDMTTPAGERFNYDF
    TRAMGTLPLRDGLTSQLTASYISGKLTVTARRDAGWQQPALFIDSMEDVDFGKPSFTSRGDTLTATIPVTDSWGEAAPDL
    RGKTLSLVLADSGQAQESQIAVAAGSAAPGLALGWVLLMALVGGLILNVMPCVLPVLAMKLGSLVQTEGRERGAVRRQFL
    ASVFGIVVSFLALALMMTALRLGNQALGWGIQFQNPWFIGAMALVMVLFSASLLGLFEIRLSSSASTFLATRGGNGLMGH
    FWQGAFATLLATPCTAPFLGTAVSVALVAPLPLLWGIFFAMGIGMSLPWLLIVAWPGLAQRLPRPGRWMNHLRVVLGLMM
    LGSALWLVSLLTIHIGRTPVLTLLVILAIALLVATAWRYRWRTALRAGALAIVVAGAVAFVAQQDGQGPRRDRVNWQPLS
    EQAIASALAEHKRVFIDVTADW
    CVTCKANKYNVLLRDDVQQALLAPDVVALRGDWSRPSADISQFLTARGSAAVPFNQIY
    GPELPQGQILPVLLDREHLLATLSAAKGK

    >gi|238896445|ref|YP_002921183.1| copper-sensitivity suppressor protein C [Klebsiella pneumoniae NTUH-K2044]
    MRAITALLLLCVSAFSFAAPAEEPQSNGNDQLAQLLFNDPNSPRTGAKEPKLTIVSFTDYNCPYCKQFDPLLEKIVHDNP
    DIQLIVKLLPFKGQSSVNAAKAALSTWRQQPDKFWALHQRLMAKKGYHDDASIAAAQKKTATDSVNIDDKTMDSLKMNLI
    LSQVLNIQGTPATIIGDQMVAGAIPADELEGLVKEQLAKARGQ

    >gi|238896446|ref|YP_002921184.1| copper-sensitivity suppressor protein D [Klebsiella pneumoniae NTUH-K2044]
    MASKIRRWLRELAVWLLIGAAVSLAVDYFRQPALPQNVSATSLQTLDGRTLDLNAMSQQKPLLLYVWATWCGVCRYTTPS
    VASLAADSGNVLTIALRSGDNAALEKWLTRKKMTLPTVNDPSGQLARQWDIQVTPTLVVISQGEVKSVTTGWTSSWGMRL
    RLWLASW

    >gi|238896888|ref|YP_002921633.1| thiosulfate sulfurtransferase [Klebsiella pneumoniae NTUH-K2044]
    MEQFECINVEEAHQKLHQQTAVLVDIRDPQSYAMGHTPGAFHLTNDTLGAFMRDNDFDTAVMVMCYHGNSSKGAAQYLLQ
    QGFDKVYSVDGGFDAWHRHFPAEVARGTF

    >gi|238896932|ref|YP_002921677.1| P-type Pb/Cd/Zn/Hg transporting ATPase [Klebsiella pneumoniae NTUH-K2044]
    MSTPDAQDKKVPQFSSFTMRPATAPAESCCTDHACATESAPAAEALSDARYRWQVDGMDCAACARKVETAVRQVPGVSQV
    QVLFATEKLLVNAEGDVRAQVENAVRQAGYTLRDADAPAAEQTRGSLLRDNLPLLTLVIMMALSWGLEQANHPAGQLAFI
    ATTLVGLWPVARQALRLIKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPD
    TAIRLRNGVRETVAQRDLRPGDVIEVAAGGRLPADGQLLSPFASFDESALTGESVPVERQAGERVAAGATSVDRLVQLTV
    ISEPGDSAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMVVALLVAIVPPLFFASAWLPWIYKGLTLLLIGCPCALV
    ISTPAAITSGLAVAARRGALIKGGAALEQLGQVRQVAFDKTGTLTVGQPQVTSVIATAEVDDNALLALAAAVEQGSSHPL
    AQAIVREAQRRQLSIPLASGQRALAGSGIEAEVNGSRILICAASKAAPAEHEAQIQQLESAGQTVVLVMRGETLLGILAL
    RDTLRDDARQAVNALHQLGVQGVILTGDNPRAAAAIASELGLEFRAGLLPADKVNAVIALNADAPLAMVGDGINDAPAMK
    AATIGIAMGSGTDVALETADAALTHNRLTGLAQMISLARATHANIRQNIAIALGLKGIFLVTTLLGLTGLWLAVLADTGA
    TVLVTANALRLLRKKL

    >gi|238896964|ref|YP_002921709.1| glutathione reductase [Klebsiella pneumoniae NTUH-K2044]
    MSKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINHFD
    WEKLVASRSAYIDRIHTSYDNVLGKNKVDVIKGFARFVDAHTVEVNGEIITADHILIATGGRPSHPDIPGVEYGIDSDGF
    FELPALPKRVAVVGAGYIAVELAGVINGLGAETHLFVRKHAPLRSFDPLIVETLVEVMNTEGPQLHTNAIPKAVVKNADG
    SLTLELEDGRSQTVDCLIWAIGREPATDNFNLAATGVKTNDKGYIIVDKFQNTNVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPEEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDAVKVYKSSFTAMYTAVTSHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|238897054|ref|YP_002921800.1| glutaredoxin 3 [Klebsiella pneumoniae NTUH-K2044]
    MANIEIYTKATCPFCIRAKALLNSKGVTFHELPIDGDAAKREEMIQRSGRTTVPQIFIDAQHIGGCDDLYALDSRGGLDP
    LLR

    >gi|238897094|ref|YP_002921840.1| putative methylated-DNA-[protein]-cysteine S-methyltransferase [Klebsiella pneumoniae NTUH-K2044]
    MKITDSMQCDIWYQALLERAVEFTGVFFVGVKTTGVFCISVCRARKPRRENVEFYNDFKSALDAGFRPCKVCRPTENART
    APAFVEQALRLLREAPKVRLSDSELRQHDISPERVRRWFLQNHGITFQAFQRMQRLNMALQELKAGRSTTDVAFDSGYES
    LSGFGYTCKKLTGFAPSAQRQVVLIHRFTTPLGPMFVCATQRGICLLEFVDRRALESEFSDLQRRFNASIIAGENAHTRQ
    AQQEITEYFAGQRQSFEVALDTPGSEFQRAVWRRLQHVSFGETTHYQSIAMEIGKPTATRAVAAANGANRVAIIIP
    CHRI
    IGKDGSMTGYGGGIARKIWLINHEATIREKRG

    >gi|238897136|ref|YP_002921882.1| hypothetical protein KP1_5396 [Klebsiella pneumoniae NTUH-K2044]
    MSRLADIREQDATGKAADIFAGIKKAMGKVPNAYLTIGGHSPAALQQALAHNAMLHKGSLSAQQLEAINLSVSEATGCDY
    CLAAHTLMAKKAGFSSEQIHALRRGEYAEETQLDALVKFAQTLVTTTGTLPEADVAALRNAGFSDQQVIEIISAISAILF
    TNMVNRVNDTVVDFPKAD