Klebsiella pneumoniae MGH 78578 uid57619

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|152968605|ref|YP_001333714.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MQILLANPRGFCAGVDRAISIVENALTLYGAPIYVRHEVVHNRYVVDSLRKRGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYNNPQGGMYLVESPEDVLKLEVKNDAR
    LSFMTQTTLSVDDTSDVIDALRARFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGK
    AAYLIDDASDIQEAWVKDAACVGVTAGASAPDILVQNVITRLQELGGGEAVPLEGREENIVFEVPKELRVDVREVE

    >gi|152968701|ref|YP_001333810.1| dihydrolipoamide dehydrogenase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKSVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKK

    >gi|152968752|ref|YP_001333861.1| hypothetical protein KPN_00171 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSDDVALPLEFTEAAANKVKHLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSV

    >gi|152968816|ref|YP_001333925.1| Na(+)-translocating NADH-quinone reductase subunit D [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAFVMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMA
    IIASLVIVVDQLLRAFAYETSKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGS
    GKLFGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE

    >gi|152968817|ref|YP_001333926.1| Na(+)-translocating NADH-quinone reductase subunit E [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTASGLGVAVTVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVN
    CAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGI
    REKMKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL

    >gi|152968927|ref|YP_001334036.1| putative thiol - alkyl hydroperoxide reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MVLVTRQAPDFTAAAVLGNGEIVEKFNFKQHTNGKPTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPVDQGGIGPVKYAMVADIKREIQKAYGIEHPDEGVALRGSFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMAASPEGVAKYLTENVSSL

    >gi|152969036|ref|YP_001334145.1| copper exporting ATPase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKEWVWSIVDRKIIQELFMSNTIDLTLDGLSCGHCVKRVKESLEQRPDVEQAEVTLTEAHVTGSASAQALIDTVKQAGYG
    AELSHPKAKPLAESSIPSEALTAATPELPAAHDEDDSQQLLINGMS
    CASCVSRVQNALAAVPGVSQARVNLAERTALVMG
    SASAAELVQAVEKAGYGAEAIEDDLQRRERQQETALATMKRFRWQAIVALLVGVPVMVWGMIGDNMMVSDDNRSLWLVIG
    LVTLAVMVFAGGHFYRSAWKSLKNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLE
    ARARQRSSKALEKLLDLTPPSARVVTPEGEKDLPLAEVQAGMTLRLTTGDRVPVDGMISQGEAWFDEAMLTGEPVPQQKG
    DGDAIHAGTVVQDGSVLFTASAVGSQTTLARIIRMVRQAQSSKPEIGQLADKISAVFVPAVVVIALISAAIWYFFGPAPQ
    IVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEYGVLVRDADALQRASELDTLVFDKTGTLTEGKPQVVAVKTFAG
    VDEHTALRLAAALEQGSSHPLARAILDKAADGPLPEVSGFRTLRGLGVSGEAEGHRLLLGNQALLNEQHINTAEVESEMT
    AQASRGATPVLLAVDGQAAALFAIRDPLREDSVDALARLHRQGYRLVMLTGDNPTTAKAIAKEAGIDEVIAGVLPDDKAD
    AIKRLQSQGHKVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLHGVADALAISKATLRNMKQNLLGAFV
    YNSLGIPIAAGILWPLTGTLLDPVVAGAAMALSSITVVSNANRLLRFKPKE

    >gi|152969042|ref|YP_001334151.1| putative thioredoxin protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSEQNIVNISEVNLQQTLQQSMNVPVLFYFWSARSQHCEQLTPVLERLAAQYNGQFTLAKVDCDAEQMLASQFGLRAIPT
    VYLFQNGQPVDGFEGPQPEEAIRALLDKVLPREEELKAQQALALMQEEKYADALPLLKEAWQLSNQESQIGLLLAETLIA
    LHRSDEAESVLKTIPLQDQDTHYQGLVAQIELLKQAADTPEIQQLQQQVEQNPEDAQLASQLALQLHQVGRNEEALALLF
    SHLQKDLGAGDGQARKMLQEILAALGTGDALAAKYRRQLYSLLY

    >gi|152969220|ref|YP_001334329.1| disulfide isomerase, thiol-disulphide oxidase, periplasmic [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKGWLGKYQDMGVTIYLTPDGKHAISGYMYDENGNNLSEQLFQKELYTPAGQEMWKKMASAHWLQDGNKDAPIVLYVFAD
    PF
    CPYCKQFWQQSRPWVEAGKVQIRTLLVGVIKPESPATAAAILATKDPAKTWHDYEQSNGKMALTIPKAIPPEKMKMLN
    VNQQLMDDLGANVTPAIYYMNKDNMLQQVVGLPDKEKLHIMMGEKE

    >gi|152969221|ref|YP_001334330.1| alkyl hydroperoxide reductase subunit C [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|152969222|ref|YP_001334331.1| alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAVRKPSFLITNPGSDQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQ
    NEITERNVMGVPAVFMNGQEFGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEGGLHQIETASGAVLKARSVII
    ATGAKWRNMNVPGEEQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKV
    RSLKNVDIILNAQTTEVKGDGSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
    KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA

    >gi|152969416|ref|YP_001334525.1| molybdopterin biosynthesis protein MoeB [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTVELSDEEMLRYNRQIVLRGFDFDGQERLKAARVLVVGLGGLGCAAAQYLAAAGVGQLTLLDFDTVSLSNLQRQTLHSD
    ATLGQPKVDSAREALARINPHVRLVPLNALLDETALAAQIADHDLVLDCTDNVAIRNQLNVGCFQHKTPLVSGAAIRMEG
    QISVFTYQDGEPCYRCLSRLFGENALT
    CVEAGVMAPLVGTIGSLQAMEAIKLLSGYGTPASGKIVIYDAMTCQFREMRLM
    RHPQCEVCGSH

    >gi|152969437|ref|YP_001334546.1| glutaredoxin 1 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MFTVIFGRPGCPYCVRAKELAEKLTNERDDFNYRYVDIHAEGISKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAK
    ENLGLFA

    >gi|152969477|ref|YP_001334586.1| thioredoxin reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MYANYYGDLMGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHE
    HAAKFETEIIFDHISRVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAV
    IGGGNTAVEEALYLSNIASEVHLIHRRDSFRAEKILIKRLMDKVASGNIVLHTDRTLEEVTGDQMGVSGLRLRDTKNSDN
    VESLEVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAE
    RYLDGLADACK

    >gi|152969623|ref|YP_001334732.1| hypothetical protein KPN_01069 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MLAETEPRTTISFYKYFTIVDPQATRDALWVALTQLKVFGRIYLAREGINAQISVPQSNVEALREFLYGFDPALAGLRFN
    IAVEDDGKSFWVLRLKVRDRIVADGIDDPSFDASNVGEYLKAAEVNAMLDDPDAVFIDMRNHYEYEVGHFENALEIPADT
    FRDQLPKAVEMMQDHKDKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGLPVRFIGKNFVFDERMG
    ERISNDVIAHCHQCGAPCDTHTNCLNDGCHLLFIQCPSCAEKFAGCCSEACMEEHKLPEEEQRKLRAGRENGNKIFNKSR
    GRLNTKLGILDPEPSEKP

    >gi|152969744|ref|YP_001334853.1| putative glutathione peroxidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTPFYQLTATRLRGQPLSMADYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVLGFPCNQFGKQEPGGADEIEQ
    TCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGGRIKWNFTKFLIGRDGTPLTRFAPFTTPEKMEASIVAALTR


    >gi|152969752|ref|YP_001334861.1| methionine sulfoxide reductase B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MANKPTPEELKNGLSEMQFYVTQHHGTEPPFTGRLLHNKKNGVYHCLVCDAPLFNSQTKYDSGCGWPSFYEPVSAEAIRY
    LTDNSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLSFTDEQNGEQIKG

    >gi|152969761|ref|YP_001334870.1| selenophosphate synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETSDDAAVYDLGNGTSIVSTTDFFMPIVDNPFDF
    GRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIAREVVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RIKKNSTAQAGCKLYLTKPLGIGVLTTAEKKSLLKPEHQGLATETMCQMNLAGAAFATIDGVKAMTDVTGFGLLGHLSEV
    CRGAGVQAQLRYADIPKLPGVEDYIAAGAVPGGTGRNFASYGHLMGEMPTEWRDLLCDPQTSGGLLLAVTPEAEAEVQAA
    AAEFGIKLAAIGELVTARGGRPMIEIR

    >gi|152969767|ref|YP_001334876.1| putative thiosulfate sulfur transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKRVSQLTALALLMGLAASTTCAAETMPALTLSHLQQQHGVAIDTRLSAYYNGWPQRANGPEGHEPQALNLSARWLGAMS
    DDQLRAWAKQHQLQSDTPIALYGSPADNASVAARLKQTGFTRLSTLSDALSQTDRLQKLPHFEQLVYPQWLHDLQQGKAV
    AAAPAGDWKVFEAAWGAPKLYLLSHIPGAGYIDTNEVESEPLWNKVSDAQLKAMLAKHGIRHDTTVILYGRDVYAAARVA
    QIMLYAGVKDVRLLDGGWQTWSDAGLPVERGMPPAQQPAPDFGAPIPGQPQLMLDTEQARGLLHRQDASLVSVRSWPEFI
    GTTSGYSYIKPKGDIAGARWGHAGSDSTHMEDFHNQDGTMRSADDIAALWRQWNILPSQQVAFY
    CGTGWRASETFMYARA
    MGWPHVAVYDGGWYEWSSNPHNPVARGERGPESSQ

    >gi|152969771|ref|YP_001334880.1| hypothetical protein KPN_01217 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSLPPLDSVPLILRPQAWLHRRHYGQVLSPIRWWGRIPWLFYLVSLFVGYIERRRSPLDPVLRSLVSARIAQLCHCEFCI
    DITSMTLAARSGSQDKLLAVADWRSSTLFSEKERLALAYAEAATQTPPAVDDALRSAMAAHFDARALTELTALIGLQNLS
    ARFNAAMAIPAQGLCQIPTSSSQNKE

    >gi|152970058|ref|YP_001335167.1| putative inner membrane protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTWQSFKQAWLIRFWSPVPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLLGVHSEQWGYYQLIHLEGSPLTRID
    GRMIIGMFGGCLAAALWANNVKLRLPRSRIRIAQAVAGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWLFAIATAIGSW
    FGARFTLLPLFRIPVKIQKVSTASPLTQKPQQARRRFRLGMVVFFAMIGWGLLTAADHPALGLAMLFGIAFGLLIERAQI
    CFTSAFRDMWITGRTVMAKAIIFGMAASAIGIFSYVQLGMAPKIMWAGPNAAIGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTLLAWCWDDIAAPLATHWQKVNLLNAFGPFGGLLATYLLLLIALLLVIAWERHFFRRQAAVRTVKE
    SA

    >gi|152970083|ref|YP_001335192.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTETMLTLLQDKMDTPLGPLWVLCDEQFNLRAVEWDEHRDRMETLLDVHYRREGYQRVDCRNPGGLSSKLSDYFAGDLAI
    IETLPTATAGTPFQRQVWQALRDIPCGQVMHYGQLAKALGRPGAARAVGAANGANPVSIVVP
    CHRVIGRNGTMTGYAGGV
    QRKEWLLRHEGYLLL

    >gi|152970357|ref|YP_001335466.1| putative cytochrome c biogenesis protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MLTLLSPCTLPVIPLLFASVRGRRGQLAIMLAGMALMFGAVSWLVTVASGWVVNLTLAGRGLALAFFALVGLSLLSQRVA
    QRLTSPLVALGNQLNDASSRQRGWIGSLLAGLAVGLLWAPCAGPVLGAILSLGFVHPGQATTGGLLLAYGSGGALMLFLL
    GWCGAALIARLRRGQAFGERLRRLAGGAMLASVALIASGGDRYLQSAGGLSQALEQRLAARLPQPEQKTSLQPIAAPQPS
    SAMPSLAGGSAWINSPALTPERLKGKVVLVDFWTRE
    CINCQHTLPYVRDWANKYRAAGLVVIGVHTPEYPWERSLPLLRQ
    AVKDWRITYPVVADNEYAIWNAFGNQYWPAHYIFDARGQLRYTAFGEGDYARQEQVIQQLLQESKA

    >gi|152970383|ref|YP_001335492.1| osmotically inducible protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MAIHKKGLAHWEGDLKHGKGTVSTESGALSQQPYGFNTRFEGVKGTNPEELIGAAHAACFSMALSLMLSEEGYTATSIDT
    TAVVTLNKTDGGFAITDIALQSQIVLPDVSPAAFDEIIQKAKAG
    CPVSQVLKANITLDYQLNP

    >gi|152970411|ref|YP_001335520.1| hypothetical protein KPN_01859 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTLSQDILAELAEIAPGSPLDQARAVRDAATRHAQGSYEVLFRQQDADFPLDERFAVAAKVAKLHQADALAAHYAGFGLA
    DPTTDRLVPALAFARLLTFTPVEATPGALHTLTSAGWSLRGIVTLAQLVAFVSFQSRLLLGLRALNHKPIVSADTPLVAG
    YWHTTPYAQSGKAAPVRFTRDELHWEPWLADKPLAEFNAEEQAILAKYGHSDSPYFRLLARNQPVLEQRTLTDRGIFYTA
    GGLPRAERELAATVASKINGCIY
    CASVHARKAAQLAKDETAVDTLLAVTPGEDLRDGQSPRWQAEIDAAAALSVTPPALN
    ADHLAALDEQGLDTLAQLDLLQSAAFFAWANRLMLTLGEPWRE

    >gi|152970516|ref|YP_001335625.1| Na(+)-translocating NADH-quinone reductase subunit E [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MMADYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLVYLRTLAFIL
    VIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINLGHNFLQSALYGFAAAVGFSLVMVLFAAIRERLV
    VADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|152970521|ref|YP_001335630.1| SoxR-reducing system protein RsxE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSEVKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISSLRRWTPAEIRIPIYVMIIASVV
    SVVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPALSALDGFSIGMGATCAMFVLGSLREILGNGTLFDG
    ADSLLGSWAKVLRIEVFHADTPFLLAMLPPGAFIGLGMMLAIKYLIDERSKQRKAQAARAVSVAPSDVTGKA

    >gi|152970525|ref|YP_001335634.1| glutathionine S-transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKLFYKPGACSLASHIALRESGLDFTLQSVDLAQKRLENGEDYLLINPKGQVPALLLDDDILLTEGVAIMQYIADQVPDR
    HLLAPVGSIARYQTLEWLNYVATELHKSFTPLFRPDTPEDYKPVARGLLEKKLQYVDAALADKQWLTGHRFTIADGYLFT
    VLRWAYAIKLDMAAYGHIGSWMTQVAARPAVAAALAAEGLK

    >gi|152970544|ref|YP_001335653.1| hypothetical protein KPN_01992 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSSTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYHTDEPKAE

    >gi|152970624|ref|YP_001335733.1| heme lyase/disulfide oxidoreductase (thiol:disulfide interchange protein) [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MNRKLLFIPLVLFLALAAALFWQLMRNAEGDDPTTLESALIGKPLPEFRLEALNTPGQTLDRRTLIDGKPLLLNVWATWC
    PT
    CRAEHQFLNGLAQQGVRVVGMNYKDDRQKAMSWLQRLGNPYRLSLYDGNGMLGLDLGVYGAPETFLIDGQGIIRWRHA
    GDLNERVWREELQPLWDQYNRRAG

    >gi|152970663|ref|YP_001335772.1| putative rhodanese-related sulfurtransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSTYAYRQAAGIRQALLDRRELALIDVREEADFATAHPLFAVNLPLSKLELEVRRRIPRFTTPLTVYDNGEGLAEIAVER
    LRSWGYQDVALLAEGLAGWRRSGGELFQDVNSASKAFGELVESVRHTPSLSAQEVQALIDSRQEVVIVDARRFDEYQTMS
    IPGSISVPGGELALRVESLTPSPQTPVIVN
    CAGRTRSIIGTQSLINAGVPNPVHALRNGTIGWTLAGQTLAHQQQRQYDP
    AARASGARAAAVAHFAERAGVAVIDEATLQRWLQQSDRTTFLFDVRSPEEYAAGHYPGSLSAPGGQLVQETDHFASVRGA
    RIVLLDDDGIRAAITGSWLAQMGWETARLSALSTSQLSERGVPAAEVPPGPQAEEISPAQLAQQLEEPGTVVLDFTTSAN
    FVARHIPGAWWLTRSQLRQALDVIPPAQRYVVT
    CGSSLLARYAVPEVAALTGKPVQLLTGGTLAWIAAGLPLAHGDSGLA
    VERRDRYRRPYEGTDNSAEAMQAYLEWEYGLVDQLARDGTHGFRVL

    >gi|152970690|ref|YP_001335799.1| iron-sulfur cluster assembly scaffold protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MEVQAGTFNPADFSWQGLTMTPAAAAHIRDLMRKQPDKKGLRLGIKTSGCAGFGYVLEMIAEPAPDDLLFESDGAKLFAP
    LQAMPFIDGTELDYVREGLNEIFKFHNPKAQHECGCGESFGVQAE

    >gi|152970713|ref|YP_001335822.1| hypothetical protein KPN_02164 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTLSFTTHWRDELPDFYTSLSPTPLDNARLIWRNAPLAQQLGVPDALFAPESGAGVWGGEALLPGMSPLAQVYSGHQFGA
    WAGQLGDGRGILLGEQQLADGRRYDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHALGIPTTRALAMVTSDTPVY
    RERVEPGAMLMRVAESHVRFGHFEHFYYRREPQKVQQLADYVIRHHWPQLQDEADKYLLWFRDIVMRTAQTIASWQTVGF
    AHGVMNTDNMSILGLTIDYGPYGFLDDFQPDFICNHSDYQGRYSFENQPAVGLWNLQRLAQSLSPFISAEALNAALDEYQ
    HALLTAYGQRMRDKLGLFSQQKGDNDLLDGLFALMIREKSDYTRTFRLLSHSEQLSAASPLRDEFIDRAAFDSWFAGYRA
    RLRDEQVDDAQRQQRMQGVNPALVLRNWLAQRAIEQAEAGDMGELERLHAALADPFTDREDDYVRRPPDWGKRLEVS
    CSS


    >gi|152970716|ref|YP_001335825.1| putative glutathione peroxidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MQHDILNTEVTTIDGEKTTLASFAGKVLLIVNVASKCGLTPQYEQLEDLQKQFAAEGFSVLGFPCNQFLGQEPGSEEEIK
    TFCSTTYGVTFPLFSKIDVNGEHRAPLYQKLIAAAPKAVAPEGSGFYERMASKGRAPLYVDDILWNFEKFLINRQGNVIQ
    RFSPDMTPDDPQLVAAIKGALAQ

    >gi|152970772|ref|YP_001335881.1| putative phosphatase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MQRIVIIANGAAYGSESLFNSLRLAIALREQQSDLDLKLFLMSDAVTAGLRGQKPAEGYNVQQMLEILTAQQVPVKLCKT
    CADGRGVSALPLVDGVEVGTLVELAQWTLAADKVLTF

    >gi|152970860|ref|YP_001335969.1| disulfide bond formation protein B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MALTAFILELVALWFQHVMLLQPCVMCIYERCALFGIMGAGLVGAIAPKTPLRYVAMAIWLYSAIRGLQLAWEHTMIQLH
    PSPFQT
    CDFAARFPTWLPLDKWLPQVFVASGDCSVRQWQFLSLEMPQWLVGIFAAYLLVAILVIVAQPFKAKKRDLFGR

    >gi|152971172|ref|YP_001336281.1| O6-methylguanine-DNA methyltransferase; transcription activator/repressor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKPIVADTDDRRWQAVCERDTRADGQFVFAVLTTGICCRPSCRSRRARRENVRFFADVAAAVAAGFRPCKRCQPDKDYPQ
    QQRVDKVAQACRLLEQDAPLTLEALAGQLAMSPFHFHRLFKSVTGMTPKAWQQAWRAQRLREALEQGIPVTRAALAAGFP
    DSSSYYRQADAALGMTASQFRRGGAATVVTWTTGDCALGRCLVAQSERGVCAVLPGDNDAALLDDLRRRFPNAELREGDP
    DFCQQMAEIFAHLDDSRRPVSLPLDLQGTAFQLQVWQALRQIPAGETRSYRQVAEHIGQPRAVRAVAGACAANSLAVIVP
    CHRVVREDGALSGYRWGTARKAQLLAREAQHEEE

    >gi|152971335|ref|YP_001336444.1| hypothetical protein KPN_02804 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MLTMYGIKNCDTIKKARRWLEAHQIEYRFHDYRADGLERAQLDTFIAELGWQALLNTRGTTWRKLDESLRNSIDNADAAA
    ALMLEMPAIIKRPLLCAPGRPMLLGFSEASYQQFNEV

    >gi|152971345|ref|YP_001336454.1| thioredoxin-dependent thiol peroxidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTPLKAGDIAPKFSLPDQDGEEVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKENA

    >gi|152971348|ref|YP_001336457.1| putative arsenate reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MTDAVKIYHNPRCSKSRETLSLLQSRGIDPEVVLYLETPPDAGTLRQLLQLLGMESPRELMRQKEDLYKSLNLADPALSN
    AALIQAMVDNPKLIERPIVVSRGQARIGRPPEQVLEIVS

    >gi|152971382|ref|YP_001336491.1| 3-mercaptopyruvate sulfurtransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSTSFFVAADWLAEHIDDPEIQIIDARMAPAGQEALRDMAAEYRAGHVPNALFFDIEALSDHTSPLPHMMPRAEAFAVAM
    RELGVCSDKHLVVYDEGNLFSAPRAWWMLRTFGVEKVSILAGGLEGWRRDELPLEQGMPEVAEGEFDVRFDPQQIKRLTD
    VLLVSHEGSAQIVDARPAARFNGQADEPRPGLRRGHIPGALNVPWTDLVINGELKTVDELNDIFLRQGVDFERPIIAS
    CG
    SGVTAAVVVLALTTLGVNGVCLYDGSWSEWGARSDLPIEPAPAAP

    >gi|152971391|ref|YP_001336500.1| iron-sulfur cluster assembly protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSITLSDSAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPAAEDTVFEDKGVKVVIDGKSLQFLDGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFNV

    >gi|152971436|ref|YP_001336545.1| thioredoxin 2 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MNTVCASCQALNRLPDDRSADGAKCGRCGHDLFDGDVINATGATLDKLLKDDLPVVVDFWAPWCGPCRSFAPIFEDVAEE
    RSGKMRFVKVNTEAERELSARFRIRSIPTIMMFKNGEVIDMLNGAVPKAPFDSWLNEAGQQ

    >gi|152971530|ref|YP_001336639.1| hypothetical protein KPN_03003 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MNQLRQPFSELSPEVYKGLIQASIALEKSELGNALVELVYLRVSQINGCAFCLEKHSQALRKGGMAQSKLDALAGWRVSA
    HFTPAERAALAWAESVTDIATSHAEDEVYQPLREHFTPRQISDLTFAVSLMNAFNRLAVAMRL

    >gi|152971608|ref|YP_001336717.1| hypothetical protein KPN_03086 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MNSKAAITITYCSQCNWMLRASWMAQELLHTFSTDIASVTLVPGTGGIFTIDVDGQQIWERKQDGGFPDAAELKRRVRDV
    CFPEKPLGHVDKGDQKG

    >gi|152971822|ref|YP_001336931.1| arsenate reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSITIYHNPDCGTSRNTLALIRNSGAEPTVIYYLETPPSGDELRQLLAAMGIPVRALLRKNVEPYDALGLAEDRFTDDQI
    IDFMLQHPILINRPIVTTPQGTRLCRPSEVVLEILTAPQKGAFVKEDGEPVIDAAGQRVK

    >gi|152971839|ref|YP_001336948.1| thiol:disulfide interchange protein DsbC [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYVTDDGKHIIQGPMYDVSGAQP
    VNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDIT
    CGYCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAI
    WCAKDRNKALDDAMNGKGVQPASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN

    >gi|152971851|ref|YP_001336960.1| suppression of copper sensitivity protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MYMVFRRLLVCLLWLWLPVSQAADSGWLRAADNQHASVRLRAQTESNGDTRLLLDVALEKGWKTYWRSPGEGGIAPAIAW
    HTPLEVRWRWPTPQRFDVAGISTQGYHGDVSFPMTLRGKIPPTLSGVLTLSTCSNVCILTDYPFSLDMTTPAGERFNYDF
    TRAMGTLPLRDGLTSQLTASYISGKLTVTARRDAGWQQPALFIDSMEDVDFGKPSFTTRGATLTATVPVTDSWGEAAPDL
    RGKTLSLVLADSGQAQESQIAVAAGSAAPGLALGWVLLMALAGGLILNVMPCVLPVLAMKLGSLVQTEGRERGAVRRQFL
    ASVCGIVVSFLALALMMTALRLGNQALGWGIQFQNPWFIGAMALVMVLFSASLLGLFEIRLSSSASTFLATRGGNGLMGH
    FWQGAFATLLATPCTAPFLGTAVSVALVAPLPLLWGIFFAMGIGMSLPWLLIVAWPGLAQRLPRPGRWMNHLRVVLGLMM
    LSSALWLVSLLTIHIGRTPVLTLLVILAIALLVATAWRYRWRTALRAGALAIVVAGAVAFVAQQDGQGPRRDRVNWQPLS
    EQAIASALAEHKRVFIDVTADW
    CVTCKANKYNVLLRDDVQQALLAPDVVALRGDWSRPSADISQFLTARGSAAVPFNQIY
    GPELPQGQILPALLDREHLLATLSAAKGK

    >gi|152971852|ref|YP_001336961.1| suppression of copper sensitivity protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MRTITALLLLCVSAFSFAAPAEEPQSNGNDQLAQLLFNDPNSPRTGAKEPKLTIVSFTDYNCPYCKQFDPLLEKIVHDNP
    DIQLIVKLLPFKGQSSVNAAKTALSTWRQQPDKFWALHQRLMAKKGYHDDASIAAAQKKTATDSVNIDDKTMDSLKMNLI
    LSQVLNIQGTPATIIGDQMVAGAIPADELEGLVKEQLAKARGQ

    >gi|152971853|ref|YP_001336962.1| hypothetical protein KPN_03335 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MASKIRRWLRELAVWLLIGAAVSLAVDYFRQPALPQNVSATSLQTLDGRTLDLHAMSQQKPLLLYVWATWCGVCRYTTPS
    VASLAADGGNVLTVALRSGDNVKLERWLTRKKMTLPTVNDPSGQLARQWDIQVTPTLVVISQGEVKSVTTGWTSGWGMRL
    RLWLASW

    >gi|152972299|ref|YP_001337445.1| thiosulfate sulfurtransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MEQFECINVEEAHQKLHQQTAVLVDIRDPQSYAMGHTPGAFHLTNDTLGAFMRDNDFDTAVMVMCYHGNSSKGAAQYLLQ
    QGFDKVYSVDGGFDAWHRHFPAEVARGTF

    >gi|152972343|ref|YP_001337489.1| zinc/cadmium/mercury/lead-transporting ATPase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSTPDAQDKKVPQFSSFTMRPATAPAESCCTDHACATESAPAAEALSDARYSWQVDGMDCAACARKVETAVRQVPGVSQV
    QVLFATEKLLVHAEGDVRAQVENAVRQAGYTLRDADAPAAEQTRGSLLRDNLPLLTLVIMMALSWGLEQANHPAGQLAFI
    ATTLVGLWPVARQALRLIKSGSWFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPD
    TAIRLRNGVRETVAQRDLRPGDVIEVAAGGRLPADGQLLSPFASFDESALTGESVPVERQAGERVAAGATSVDRLVQLTV
    ISEPGDSAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMVVALLVAIVPPLFFASAWLPWIYKGLTLLLIGCPCALV
    ISTPAAITSGLAVAARRGALIKGGAALEQLGQVRQVAFDKTGTLTVGQPQVTSVIATAEVDDNALLALAAAVEQGSSHPL
    AQAIVREAQRRQLSIPLASGQRALAGSGIEAEVNGSRILICAASKAAPAEHEAQIQQLESAGQTVVLVMRGETLLGILAL
    RDTLRDDARQAVDALHQLGVQGVILTGDNPRAAAAIASELGLEFRAGLLPADKVNAVIALNADAPLAMVGDGINDAPAMK
    AATIGIAMGSGTDVALETADAALTHNRLTGLAQMISLARATHANIRQNIAIALGLKGIFLVTTLLGLTGLWLAVLADTGA
    TVLVTANALRLLRKKL

    >gi|152972374|ref|YP_001337520.1| glutathione reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MGMSKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHLYGPDYGFDTTINH
    FDWEKLVASRSAYIDRIHTSYDNVLGKNRVDVIKGFARFVDAHTVEVNGEIITADHILIATGGRPSHPDIPGVEYGIDSD
    GFFELPALPKRVAVVGAGYIAVELAGVINGLGAETHLFVRKHAPLRSFDPLIVETLVEVMNAEGPQLHTNAIPKAVVKNA
    DGSLTLELEDGRSQTVDCLIWAIGREPATDNFNLAATGVKTNDKGYIIVDKFQNTNVPGIYAVGDNTGAVELTPVAVAAG
    RRLSERLFNNKPEEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDAVKVYKSSFTAMYTAVTSHRQPCRMKLVCVGP
    EEKIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|152972460|ref|YP_001337606.1| glutaredoxin 3 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MANIEIYTKATCPFCIRAKALLNSKGVTFHELPIDGDAAKREEMIQRSGRTTVPQIFIDAQHIGGCDDLYALDSRGGLDP
    LLR

    >gi|152972498|ref|YP_001337644.1| putative methylated-DNA-[protein]-cysteine S-methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKITDSMQCDIWYQALLERAVEFTGVFFVGVKTTGVFCISVCRARKPRRENVEFYNDFKSALDAGFRPCKVCRPTENART
    APAFVEQALRLLREAPKVRLSDSELRQHDISPERVRRWFLQNHGITFQAFQRMQRLNMALQELKAGRSTTDVAFDSGYES
    LSGFGYTCKKLTGFAPSAQRQVVLIHRFTTPLGPMFVCATQRGICLLEFVDRRALESEFSDLQRRFNASIIAGENAHTRQ
    AQQEITEYFAGQRQSFEVALDTPGSEFQRAVWRRLQHVSFGETTHYQSIAMEIGKPTATRAVAAANGANRVAIIIP
    CHRI
    IGKDGSMTGYGGGIARKIWLINHEATIREKRG

    >gi|152972536|ref|YP_001337682.1| hypothetical protein KPN_04032 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSRLADIREQDATGKAADIFAGIKKAMGKVPNAYLTIGGHSPAALQQALAHNAMLHKGSLSAQQLEAINLSVSEATGCDY
    CLAAHTLMAKKAGFSSEQIHALRRGEYAEEMQLDALVKFAQTLVTTTGTLPEADVAALRNAGFSDQQVIEIISAISAILF
    TNMVNRVNDTVVDFPKAD

    >gi|152972670|ref|YP_001337816.1| periplasmic protein disulfide isomerase I [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MKKVWLALAGMILAFSASAAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHV
    EFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKNQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
    ADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK

    >gi|152972751|ref|YP_001337897.1| soluble pyridine nucleotide transhydrogenase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSHSWDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADSVINQQTHMRQGFYERNHCEILQGNAHFVDEHTLALECHDGTVETVTAEKFVIACGSRPYHPADVDFHH
    PRIYDSDSILSLQHEPRHVIIYGAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGVDDGVIMHLKSGKKLKADCLLYANGRTGNTDTLALENIGLQTDSRGQLKVNSMYQTALPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEASAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMSVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|152972775|ref|YP_001337921.1| thioredoxin [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|152972854|ref|YP_001338000.1| thiamine biosynthesis protein ThiF [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MNDHDFMRYSRQLLLEDIAIEGQQKLLASRVLIIGLGGLGSPAALYLAGAGVGTLTLADDDAVHLSNLQRQILFTSADID
    RPKAAAAQTRLSQLNPQIKLVALQQRLSGEALRAEVAKADVVLDCTDNMVTRQAINAACVALDTPLVTASAVGFGGQLMV
    LTPPWTQGCYRCLWPESDEPQRN
    CRTAGIVGPVVGMMGTLQALETIKLLSGMATPRNTLRLFDARTSNWRALALQRSRSC
    PVCGGRHADLV

    >gi|152972987|ref|YP_001338133.1| putative DSBA oxidoreductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSGHKKYLSVALLSAVLLPAMASAADAPATFTPEQEAKIGKIAADYLVAHPEVLLQASQKLQQIQAEQQASAATQAVLKN
    AAVLTQDKNTPTYGPANGKVTVIEFFDYQ
    CVYCSRLAPVMEQVIKAHPQTRFAFKEWPIFGGRWESSLEAAKTGLQIYQQ
    KGADAYLAYHNGIYATGHNEGKLTTADIQQQAKKAGFDAKKAADVEPVLQSINDLAQEIGLSGTPGVIVMPTTGATEASI
    TVFPGLADKASLEAAIKKAGG

    >gi|152973001|ref|YP_001338147.1| thiol:disulfide interchange protein precursor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MAYRIITLILLLCSTSATAGLFDAPGRSNFVPADQAFAFDFQQQQHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPALP
    AGEWHEDEFYGKSEIFRQRLTVPVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLSAVRAASNDGQATAIEPMPSTS
    SRPAFNPPLPVEPRPAPELATSPAPAAVPPADTPARLPFTALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARA
    LLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGGS
    PGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILMTVFGNRLLPKSGPWMSHVKTAFG
    FVILALPVFLLERILGDQWGLRLWSMLGVAFFSWAFITSLGATRPWMRLVQIILLAAALVSARPLQDWAFGAPAVEQQAH
    LAFTRVSSVAELDQALAQAKGQPVMLDLYADW
    CVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNSPQDVALLKHLQVL
    GLPTILFFNAEGQEQSERRVTGFMDAAAFSAHLRDWQA

    >gi|152973087|ref|YP_001338233.1| methionine sulfoxide reductase A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MLKDTLRYNLNDDFCIERPTVSLFDKTHLVAQADALPGRNTPMPVATLHAVNGHSMTNVPAGMEVALFAMGCFWGVERLF
    WQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPQVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIY
    PLTPEQTEAAKASLARFQAAMNDAHDTRHITTEIATAKPFYYAEDDHQQYLYKNPHGYCGIGGIGVCLPPQA

    >gi|152973480|ref|YP_001338531.1| arsenate reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSNITIYHNPACGTSRNTLEMIRNSGNEPTVIHYLENPPSRDELVKLIADMGISVRALLRKNVEPYEELGLEEDKFTDDQ
    LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILPDAQKGAFAKEDGEKVVDEAGKRLK

    >gi|152973637|ref|YP_001338677.1| putative mercuric reductase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
    MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAIEVGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLD
    KMRDLLGRNDKTGSSGALHIAVIGSGGAAMAAALKAVEQGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNLIVQLNDGGERVVAFDRCLIATG
    ASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFR
    MEGIEVREHTQASQVAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDPGMRTSVEH
    IYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQVATVGYSEAEAHHDGIKTDSRTLTLDNVPRA
    LANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLS
    C
    CAG