Ketogulonicigenium vulgare Y25 uid59581

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|310814593|ref|YP_003962557.1| rhodanese domain-containing protein [Ketogulonicigenium vulgare Y25]
    MFLRKLIAVGAFALMAGVANANEGPLVTTEWLEENLGSADIAVIEVSVNPGVYERGHIPGAVNFAWHTDLVDPVRRDIAT
    REDLQARLQAAGVSDDTTIILYGDTNNWFAAWGAWVFDVYGLEDVKLLDGGRVAWEAEGRPLDSAVPAPAAGTVTLAEAN
    NDLRAFLPEVVAASDSGSHAIVDIRSANEYSGTIIAPEGFQETAIRAGHVTGAVNVPWSSAVAEDGRFKSPDELRAIYAA
    AGVDGSKPVITY
    CRIGERSSHTWFALSRILGYDVQNYDGSWTEYGNSVGVPVTNPAGTVWTGL

    >gi|310814594|ref|YP_003962558.1| inner membrane protein yeeE [Ketogulonicigenium vulgare Y25]
    MVTASFAARRNLWVAAGLALLIVVFLVLIPARDSLNRPLPLSMLLGVAFGALLQRSRFCFWCNYNDFLTDRDPRGLLSIL
    TALAGGTIAYAAVLHGWVPDPFAGRLPPDAFIGPIGLPLVLGATCFGLGMGLTGS
    CISAHLYRLGEGSVASIPVLVFVLV
    GFVLGFLAWNPLYLLFGSAGPVIWLPAIFGHGGALALALAGFAALAALLIRFGRFPAPEAPAQPVQPVQAIFQHRWPGVT
    AGVIVALIAIIAYFRVAPLGVTAEVGSIARTYAAGQGWLPQRLIGLDTLRGCIAVVKETLASRNGVFVLGLVLGAAVAAQ
    IAGQFKPVLPRAVSLPRLAVGGMLLGFGAMIALG
    CTVGVLLSGTMSGALSGWVFGLFCLLGGWAGGRLRRAIP

    >gi|310814626|ref|YP_003962590.1| ADA regulatory protein [Ketogulonicigenium vulgare Y25]
    METHEPYHYGLIARAIAALDAGGADMSLDDLAAKLGLSPAHLQRVFTRWAGISPKKYQQFLRANLARDLLASRHTTLDTA
    AEAGLSGTGRLHDLILQWEGMTPGAYAAKGAGVTIRHGLFDTPFGPAIVMATDQGICGIGFTSHQDPALTYRDLASRWPN
    ADFQQDGRLDSQVQAAFSGGPARLHMIGAPFQIKVWEALLAIPEGQVTTYGDIARRIGNPAAVRAVGTAVGRNPIAYLIP
    CHRVLRRDGGMGGYHWGLDSKRHLLTFEAARTEPPVISRVIG

    >gi|310814637|ref|YP_003962601.1| dihydrolipoamide dehydrogenase [Ketogulonicigenium vulgare Y25]
    MSSFDLIVIGAGPGGYVCAIRAAQLGLKTAVVEGRETLGGTCLNVGCIPSKALLHATHSLHEAQHNFDKMGLEGAAPTVN
    WDKMQAYKGDVVGQNTGGIEFLFKKNKVTWIKGWASIPAAGQVKVGDEVHTAKHIVIASGSEPASLPGVEIDEEVIVSST
    GALALKQIPKRLAVIGAGVIGLELGSVYARLGAEVTVIEYQDKITPGMDADVQRTLQRILAKQGLNFVLGAAVQGATTAE
    GGATLNYKLNKTGDEHSLTVDTVLVATGRKPFTAGLGLDTLGVALSPRGQIETDSHYATNISGIYAIGDAIAGPMLAHKA
    EDEGIAIAEILAGQAGHVNYGIIPGVIYTTPEVASVGATEEALKAEGRAYKVGKFSFMGNARAKAVFQGEGFVKLIADKE
    TDRILGVHLIGPAAGDMVHEICVAMEFGASSEDVARTCHAHPTFSEAVREAALACGSGAIHA

    >gi|310814722|ref|YP_003962686.1| Iron-sulfur cluster assembly family protein [Ketogulonicigenium vulgare Y25]
    MFTLPPTVTPRAFERLAQIGAAKQGKALRVAVEGGGCSGFQYQITLDAPQGDDLVLEGAGEKVVVDQVSLPFLASAQIDF
    SDALIGARFVIENPNASTSCGCGTSFSI

    >gi|310814767|ref|YP_003962731.1| molybdopterin biosynthesis protein MoeB, putative [Ketogulonicigenium vulgare Y25]
    MVSAALTTWEGQVSLYDPARGGPCLTCVFPHAPPVIEDCSVVGVFGPLPGIIGTMMAAEVVKALTGAGEGLRGRLMIYDA
    LYADMRIIRTKADPACPTCHGMGAVK

    >gi|310814799|ref|YP_003962763.1| OsmC-like protein [Ketogulonicigenium vulgare Y25]
    MKVFYKTRATSTGGRTGHTALDDGSLAFDLASPGSGKEGANPEQLFALGYAACFGSALELIAKQMKLDVTAKTSVEVGIG
    QTASGGYALDIDIYAETTGITEDEAHRLIEKAHEV
    CPYSNATRGNIDVRLHVVVN

    >gi|310814831|ref|YP_003962795.1| thioredoxin [Ketogulonicigenium vulgare Y25]
    MDLTADLNTKDIIIDGTDAGFMDDVIAASQQVPVIVDFWATWCGPCKTLGPALEAAVKKAGGKVRLVKIDVDKQPQFAAQ
    LRVQSIPTVYAFWQGQPVDGFQGAIPPSQVDEFVNKLSALAGDDGLGAALDAADEMMEQGAFADATEIYNAVSQEEPENA
    RAYAGLVSAALAQNDLDGAEAVLNGAPAVIAKSPELEAVRARLELARQAASAGPVDDLRAAVAADPANLQALFDLATALH
    ASGDVQGAVDSLLDLFRKDREWNDGAAKAQLFTIFDALPPKDPIALAGRRRLSSLIFA

    >gi|310814916|ref|YP_003962880.1| AhpC/TSA family protein [Ketogulonicigenium vulgare Y25]
    MPKDQPMTRLQAGDTAPNFTLPGHDGKTYHLSDFRGQRVVLFFYPADNTPTCTTENAEFATHAEAFAAAGVQLIGINRDS
    LAKHTKFAAKLALPFPLLTDEDGAVSGAYDVWQEKSTFGKTYMGILRTTFLIGTDGRLEMVWPVTRLAGHVDSVLTSCLS
    KN

    >gi|310814920|ref|YP_003962884.1| dihydrolipoamide dehydrogenase [Ketogulonicigenium vulgare Y25]
    MQKFDMIVIGAGPGGYVAAIRGAQLGLKVAVVERAHLGGICLNWGCIPTKALLRSAEVFHLMHRAKEFGLKAEGLGFDLD
    AVVQRSRGVAKQLSGGVGHLLKKNKVTVIMGEATIPAKGQVRVTTDKGTEDLTAPAIVLATGARARTLPGLEADGDLVWS
    YREALVAKRMPKNLLVIGSGAIGIEFASFFNTLGAKTTVVEVMDRILPVEDAEISAFAKKQFVKQGMTIMEKATVKQLDR
    GKGKVTAHIEANGKVEQLEFDTVISAVGIVGNVEGLGLEALGVKIDRTHVVVDEFCRTGVDGLYAIGDIAGAPWLAHKAS
    HEGVMVAELVAGQHPHAVRPESIAGCTYCYPQVASVGLTEAKAKEKGYEVKVGRFPFIGNGKAIALGEPDGLVKTIFDAK
    TGELLGAHMVGAEVTELIQGYVIGRTLETTEAELMETVFPHPTLSEMMHESVLDAYGRAIHF

    >gi|310814993|ref|YP_003962957.1| redoxin [Ketogulonicigenium vulgare Y25]
    MTIAVGDKLPSATLLRLGAGGVEQVEVDALTAGRKVVIFGLPGPFTGTCTTAHVPSFIRTRAAFADKGVDEVICIAVSDA
    FVMKAWGDSTGAIAGDISMLADPLSTFTKAIGLNFSNPAIGFVDRSLRYALFAEDGVVKVLSVEENAGQCTISGGEDLLS
    KI

    >gi|310815094|ref|YP_003963058.1| thiol:disulfide interchange protein tlpA, putative [Ketogulonicigenium vulgare Y25]
    MRKLLWAPVYTALTLMANAAMADNLADLREGDMRKLAVHERPEAASDVAFTTEDGASITLQDFQGKVTLVNFWATWCAPC
    RVEMPTLAHLQTELGGDDFQVVTIATGRNERDGMERFFDEIGVDNLPLHTDPRQALARSMGVMGLPVTLIIDREGREVAR
    LMGDADWDSDSAMAIIRAVIAQ

    >gi|310815153|ref|YP_003963117.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ketogulonicigenium vulgare Y25]
    MQDVIIVGGSYAAMAAALQLLRARRSVLIVDAGQRRNRFASHSHGFLGQDGVDPAAIWANSRAQVMKYPTVTWLDRTAVE
    LTGSIDDFTLHVEGGAAHQARRVLLATGVSDSLPEVPGMAQRWGQHIFH
    CPYCHGYELNLGQIGVIATGANSIHQAQLLP
    EWGPTTFLLNGATTLDAAQRADLAARGVTIEETPIREITGAADVVLTDGRVLSFAGLFTAPKANVNGGPALLAGAATEET
    PFGIQIRTDQGKATNIPGLFACGDGARVPHSLSLAVADGAWAGANIHRSLVFS

    >gi|310815278|ref|YP_003963242.1| arsenate reductase-like protein [Ketogulonicigenium vulgare Y25]
    MKFIGLSNCDTCKKARTAIAAAGLPIEITDIRKDGLDQALISSILDAHGDSAINKSSTTWRGLSDDEKEKPAAELLAAYP
    TLLKRPAILKDGMWHLGWKPAQQQAVLD

    >gi|310815282|ref|YP_003963246.1| Peptide methionine sulfoxide reductase [Ketogulonicigenium vulgare Y25]
    MFSLFGAKDVMVAPQDALPGRANAIQTAQTHFVNGSDLHKVPAGMEVAMFGAGCFWGVERLFWELPGVYSTSVGYAGGYT
    PNPTYEEVCTGLTGHTEVVRIVFDPAKISFDDLMKTFWENHDPTQGMRQGGDKGTQYRSAIYTYSGAQKDAALAAREAYG
    ARLAAAGFGAVTTEVLSVPNYFYAEDYHQQYLAKNPDGYCGIAGTGVTCPIGLGV

    >gi|310815437|ref|YP_003963401.1| thioredoxin reductase [Ketogulonicigenium vulgare Y25]
    MSNPRHTRVLIIGSGPAGYTAAVYAARAMLQPILVQGMEPGGQLTTTTDVENWPGEKSILGPDLMVRMEDHAREMGAEIV
    MDLITSLDLQQRPFTAVGDSGTVYTADAIILATGARAKWLGLPSEEHFRGFGVSA
    CATCDGFFYRGQEIVVVGGGNTAVE
    EALFLTNFASKVTLVHRRDSLRAEKILQERLFNHPKVEVIWNHEIVEVLGETNPRGVEGVRLRDVNTGDVRDLAAKGFFV
    AIGHAPASELVQGQLELYNGGYVKVTPGSTATSVPGVFAAGDLTDDKYRQAITSAGMGCQAALDAEHWLQAQG

    >gi|310815464|ref|YP_003963428.1| copper-translocating P-type ATPase [Ketogulonicigenium vulgare Y25]
    MDLTFHIEGMTCASCSARAQKVLSHVPGVAVADVNLATHAGRVTLADGAEASVVANALTAALGKAGYPATLTHRTLEIEG
    MT
    CASCVARVEKALAKVPGVSNATVNLATRSAQLDDLSRDADRLIAAVKRAGYDARLREVDAAPEDRDAAEAAALQRNLI
    IAAALTLPVFAIEMGSHLLGWVGLTSAAHDHGTSFTELPLTMFQFLLITAVLAWPGQVFFRRGIPALLHGAPDMNALVAV
    GAGAAWLYSTFVLFLPGLVPASGRVVYFEAAGVIVTLILAGRWLEARARGRAGAAIRRLMDLRPATALVERAGEVVELPI
    ADLRLGDIVQIRPGSRISADGRVISGTSHVDESMITGEPMPAAKTTGDSLTGGTVNGAGMLRMEVAATGSDTVLSRILSM
    VEEAQGARLPVQDLVNRITLWFVPVVMVLAAGAVLVWLVFGPEPRLSHALVAGVSVLIIACPCAMGLAGCGAGVDHRRRW
    PRGRAGCAVSQGRCAAKAGGDQDLCL

    >gi|310815500|ref|YP_003963464.1| heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase [Ketogulonicigenium vulgare Y25]
    MTTHEWNITGMDCAGCARKIKTAVERLPGTADVEVTVISERLKLALQGGANAADVESTVRDLGYGIAGVKKHDHEHGHGH
    GHDHDDPADRDRTWYQTGKGRLVILTGVLLALAWGAEWLFPAVGPLAFTLACLTGLIPVARRATAALRTGQPFTIESLMT
    IAAVGALFINAAEEAALVVFLFAVGEVLEGVATNRARQGIRALGQLVPRTALREHGNHTHEVPAASLNIGDIIQARPGER
    IAADGEIIEGTSGIDESPVTGESIPRTRGPGEDVFAGAINTQAALRIRVTRQASDNTIARIIRLVEEAEEARAPTERFID
    RFSRWYMPLIVLASLLVIVVPPLAMGQDWGTWVYRGLALLLIGCPCALVISVPASIASAMAAGARNGLLMKGGAVIEAAA
    AIRTIAFDKTGTLTEGTPKVTDIIPLTANVDEVMSVAAAVERGSSHPLAGAILSRAADLPVLPASGARDLTGMGVTAEVA
    GAPAFVTSPRTALADGVIGTDVMEQAAALEAEGKTVVTVYRRGAALGLIAMRDEPRADAAAAIARLHAMGISTTILTGDN
    PRTAAAIAETLGTAFRAEMRPEDKLTAIRDLSGAGGVMMVGDGINDAPALKQASVGVAMGGGTDVALETADAAILRSRVQ
    DIPGLIALARAAMGNIHQNVALALGLKGIFLVTSVLGYTGLWVAILADTGATVLVTLNALRLLRFSPDKKG

    >gi|310815656|ref|YP_003963620.1| hypothetical protein EIO_1175 [Ketogulonicigenium vulgare Y25]
    MMRPPAYTSLPERMYAAQRPSAVPAPRLIAYNQPLADALGLSLTLDEMAGNAIPDGAQPIAQAYAAHQFGQWNPMLGDGR
    AVLLGEAGGRDIVLKGAGRTPFSRQGDGRAALGPVLREYLVSEAMAALGIPTTRALAALETGAKVQREMPLPGAILVRVA
    ASHIRIGTFQFFAAHRDTEALGALFEHACDLHYPGAQNPMDFLHGVMAAQADLVAAWMGVGFIHGVMNTDNMSVSGETID
    FGPCAFMDGYNPGAVFSSIDTYGRYAYGNQPGIAHWNVAQLASCLMQLMPDPDAAKAQMQAAIDTFPALYEAAWLRVFGA
    KLGLKLTLETRPIAARLLDLMATDGADFTNTFANLPDARDQFLDREAFDAWQRDWLALGPDLGALKNPQVIPRNHRIESA
    IYDAMAGDFAPFHALLDAVTHPFDPNTEYARPPTEDERITRTY
    CGT

    >gi|310815681|ref|YP_003963645.1| 27 kDa outer membrane protein, putative [Ketogulonicigenium vulgare Y25]
    MDIPMRQPLFALAATLGLAGGLSAPALAFDPAAMTADEQRAFGLAVRDYLLTHPEVVMEAVDALRAKEFTAQADRDSEMV
    VALQDELFNDGYSWVGGNPDGDITIVEFMDYR
    CGYCRQAFAEVEELVAADGNIRLIIKEFPILTEGSTLSAQFALAAKLI
    YGDDTYKTLHDALITLRADATPEVLVDLANTLGLDGASIATRAASFEVSDMIGRNHDLANTLQISGTPTFILNDTMQRGY
    EPLDSMRARVAALRAEG

    >gi|310815846|ref|YP_003963810.1| Probable thiol-disulfide interchange protein [Ketogulonicigenium vulgare Y25]
    MKINPLVLIPPAVFVAIAGFFAIGMMRGDDAGLPSTLVGQELPPTNITALADLPPLTDAALRDGQVKVVNFWASWCAPCR
    LEHPNLMELSETGLPVYGVNYRDNPDDAVKFLAELGNPFTAIGTDPQARLGLEWGVYGVPETFLVGADGKIIQRIAGPLV
    GGLYDNRFRPALDAALNN

    >gi|310815858|ref|YP_003963822.1| Peptide methionine sulfoxide reductase [Ketogulonicigenium vulgare Y25]
    MNKIVKSEAEWREQLSQLAYEVTRNHATERPFTHDDFPEVAGTYYCVCCGAALFKADDKFNAGCGWPSFTQPLDGAGVGE
    SVDRSHFMVRTEVHCDQCDAHLGHVFPDGPPPTGLRY
    CINGVALRFEEAD

    >gi|310815874|ref|YP_003963838.1| HesB/YadR/YfhF [Ketogulonicigenium vulgare Y25]
    MFAIPGKQAVSLTPAAATRIRALMETAGHAGLRLGVKKGGCAGMEYTMEYADQVNPLDEIVDQDGARVMIAPMAQMFLFG
    TEIDFEDTLLHTGFKFNNPNVVEACGCGESIKFAV

    >gi|310816009|ref|YP_003963973.1| Disulfide bond formation protein DsbB [Ketogulonicigenium vulgare Y25]
    MTLNRLILIATTGSVALIAGALFFQSIGYAPCAMCHWQRWPHYTAIVIGIIALLLPQTTAKRVFAGLGALAALTTSGIGF
    FHAGVELKWWPGPQS
    CTGSGLGGLSGGDLLSMDGPRIIMCDQVSWAFMGISMAGWNAIISLFIAMIWLRAAIKGR

    >gi|310816043|ref|YP_003964007.1| uncharacterized peroxidase-related enzyme [Ketogulonicigenium vulgare Y25]
    MTDTIITYPDNVEPVAFTRDELDWLPWLHPVAEDALTDRHYTGLIDRSRAKSPYFRLLAHDPEVLGARTLADKDIFYNAK
    DGLPRAERELAAAAVSRFNGCIF
    CASVHARFAATYSKRPADVDQLLDQGVGTAIDPRWDLVIQTATTLTRTPSDLQEVDI
    SSLYEAGLSDLEVVDLIQSAAFFNWANRLMLSLGEPTA

    >gi|310816079|ref|YP_003964043.1| Glutaredoxin [Ketogulonicigenium vulgare Y25]
    MSIMIYSKPGCVQCTATARAMDARDISFEMVDVTVDANAFAAVEALGYRQLPVVVADDQHWSGFRPDRIAALA

    >gi|310816549|ref|YP_003964513.1| glutaredoxin-related protein [Ketogulonicigenium vulgare Y25]
    MSDVALNQIRETIAGNDVVLFMKGTKMMPQCGFSSRIASVLNFMAVDFADVDVLADADIRQGIKDFSDWPTIPQLYVKGE
    FVGGCDIVTEMVLSGELDTLFTNEGIAFNKESADKIREANA

    >gi|310816728|ref|YP_003964692.1| Rhodanese domain protein [Ketogulonicigenium vulgare Y25]
    MSSRHSEYLISTADLQAALADPDLVILDATTTLVPNAARTFDIVTGQADFEAAHIPGAQFVDLERDLSRPAPGLLFTLAE
    VADFAAAATRLGIGAASRVVVYSSAQPGWAVRLWLTLRAYGFSQVKVLDGGLMAWRAEDRPVDTGPARPRPLPVQPFAWR
    DDRAAFFTDTARVEQAVTSGDAILVNALGRDYFAGTAAITYGRKGNIPGSRNLPTSALVGADGRFLSADDLAQLYAAEGI
    AADQATITY
    CGAGVAASNVAFGRLLLGLDDTRVYDGSLMEWAQDPARPLVP

    >gi|310816808|ref|YP_003964772.1| thiol-specific antioxidant protein [Ketogulonicigenium vulgare Y25]
    MSLRINDVIPDLSVETDQGTIKLHDWIGDAWAVIFSHPKDFTPVCTTEFGAVAQLADEWAKRGTKVLGVSVDGVEEHVKW
    KADIETVGGAAPTFPIVADKGLELAKAFDMLPAEAYLPEGRTPNDTATVRAVFIIGPDKKLKLSMIYPMNVGRNFAEVLR
    ALNALQTSAKNGISTPANWEAGKDVVVPLTISDEDAKARFDNFQTVLPYLRTAKLRD

    >gi|310816932|ref|YP_003964896.1| rhodanese domain-containing protein [Ketogulonicigenium vulgare Y25]
    MTNPDVLVFDATQYLPNEPWDGRREYQAAHIPGAAFWDHNSVSDTDTDLPTMVPPLLRMMTATAAMGIGPGKRVVFYDQR
    HVTGAARGWWLLGLFGFDDVAILDGGFAKWQAEGRPVDSGVQNYAPTSPYSFKLRPERLRRAGDVLANLTTGDELLLDAR
    LAGRYAGTDPEPRKTMRVGHIPHSLNMPYADLLNENGTLRDGASLRAQFDALGAGADRAVIAS
    CGSGLTATIITLARVVA
    GLPQGAVYDGSWAEWGGHPELPIVAPAPALQQSAV

    >gi|310816961|ref|YP_003964925.1| Regulatory protein ada [Ketogulonicigenium vulgare Y25]
    MRYTSVMLFDLPDFQTLYDALLARDDRFDGQAYVGVSSTGIFCRLTCPARKPKPDHCTFYATIGECIAAGYRPCKRCHPL
    HAAALADPSIAALLDALEAQPDFRWSEGHIAKMGYDPSTVRRSFRRQFGMTFLEMARQRRLREGFTTLAEGGKVISAQVD
    ASFESASAFRAAFARLLGVAPAALRPDRLMRATWIPTPLGDMIAVASQSHLHLLEFVDRKALPAELARLQAATKEGIGIG
    AMPPSEQAARELDDYFAARTDRFETPLAAAGSPFTQSVWDALREIPAGETRSYSDIARRIGRPTAMRAVARANGANQIAL
    MIP
    CHRVIGADGSLTGYGGGLWRKQRLIEIERQLKATV

    >gi|310817135|ref|YP_003965099.1| glutaredoxin [Ketogulonicigenium vulgare Y25]
    MKPVQIYTTPTCGYCAAAKRLLTSKGVSYAEVDVAAHPARRAEMMERAGGRRTVPQIFIDGQHVGGCDDLYELNETGKLD
    PMLQD

    >gi|310817177|ref|YP_003965141.1| thioredoxin [Ketogulonicigenium vulgare Y25]
    MSKNTVAVTDSSFEQDVVNADVPVVVDFWAEWCGPCRMIGPALEELASEYGENVKIAKVNVDENPGIASALGIRGIPALF
    IFKEGKIVSTRAGAAPKAALKSWIDESV

    >gi|310817208|ref|YP_003965172.1| periplasmic thiol-disulfide interchange protein [Ketogulonicigenium vulgare Y25]
    MTIIRNAATAAAIALAGSFYAGTAMAQDAAATTEAAAPAITEMAVGAEDAPITFIEYASFTCPHCANFHNNQYQQLKENY
    IDTGKVRFVFREVYFDRFGLWASMIARCGDNNTRFFGINDLLYENQQGWIGSGDPAEIANNLRAIGREAGMSDAAIDACM
    ADQALAEGLVGWFTENAERDNVTATPTLFINGQQYGNMSYENLAAILDAELAKAQ

    >gi|310817232|ref|YP_003965196.1| DsbA oxidoreductase [Ketogulonicigenium vulgare Y25]
    MADDVMPSDVMKVEIWSDVICPWCWIGKARFEKALAAFPHAGRVEVTHHAYRLDPGGKPEEVVTSLGRKYGGGPDQIRQM
    MGRVVDAAAGEGLVYNTEGAKTGDTTDAHRIIKFARDKGLGDLALDRLYAAYFTDGIHVVERAALLDLASEIGLDRGEVQ
    SMLTSDAYIADVTADQAQAQRFGANGVPFFVIDGKYGISGAQEPALFARALDQIWAESGRTALKSFGDANADACGPDGCA
    I

    >gi|310830150|ref|YP_003965250.1| uncharacterized peroxidase-related enzyme [Ketogulonicigenium vulgare Y25]
    MAAFTVKALAWQPYLEPLAMEDATPAQLEAMQVTPSGGKVSPYVRTLAHDPESYAARTVLYNQIMYDEGGLSNEWRELGA
    LVASAVNKCVY
    CASVHARRYDRLSGRNDVVKELYTRGMDGTFEPKIRAVIDFSRALTQTPAGATRAQVQALLDHGFSTSD
    VSDLIHAVSIFGWANRLMHVLGHAVPAGTATK

    >gi|310830252|ref|YP_003965352.1| rhodanese domain-containing protein [Ketogulonicigenium vulgare Y25]
    MTDPLISPEKLAISLHDVVLLDATYFMPSDPVAARAAYDALRLPGARYFEIDKVADHSSDLPHMMPDAVTFGAAMAALGI
    DGSKPVVVYDRSVNHFSAPRVWFTLTAYGVPDVRVLDGGLLYWQKLGLPLEEGAPTNTATVPVKDWVLDTRRVLSGTEMA
    EVVAAGTRPIIDARGAPRFQGTAPEPRAGLTSGHMPGATNVPFDQLTDTTTGQFASVDQLETLFAEKSGTDTVLT
    CGSGM
    TAATLTLGLARIGQTGTIYDGSWTQWGRGTLGPIVTGA