Kangiella koreensis DSM 16069 uid59209

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256821251|ref|YP_003145214.1| Rhodanese domain protein [Kangiella koreensis DSM 16069]
    MQPCLQNYIGSIKQNIKEVSIDDFKCTDCSNALIIDVREPAEHAEGIIEGALPIPRGVLEFKLFSHPFLEGLSEEEILNT
    PIYIY
    CATGGRSACSAHALEQIGFKNVFSVAGGIKQWAESGGNIVKP

    >gi|256821357|ref|YP_003145320.1| Rhodanese domain protein [Kangiella koreensis DSM 16069]
    MSTFEWQESDQVQLISPEQLKQWASQQDAPLVIDVRNEDEHKTDKQQLKFVIDESLKNIPITEFGSHINQLDPDQPIVLV
    CQVGQKSFNAASLLIQADFSCVYSLHGGMEALKRSEE

    >gi|256821364|ref|YP_003145327.1| Rhodanese domain protein [Kangiella koreensis DSM 16069]
    MFKRISIEDTKQLMQDKDVLLADIRDPQSFAAGHMPDSRNINNQNAAEFIEESDKDKPLVVVCYHGNSSQPAAQYFAGQG
    FKEVYSMDGGFELWKLNNPVER

    >gi|256821366|ref|YP_003145329.1| alkyl hydroperoxide reductase, F subunit [Kangiella koreensis DSM 16069]
    MLNNQILEALKGYTAKMQKTVTFVLQTGEHSKRNELKEFLSSFVSVSDKLQLEERDLSGQVRSPISFILEADEQDTGITF
    SGIPSGHEFNSLVLAVLQAAGSPVKLDESLKKMVANVQQEMKFEVFISLS
    CHNCPDVVQALNQFALLNPNISAEMIDGGL
    FQDMVKARDIQGVPSVYLNGELFANGKVTAAELIDKLLEKDPSIAQAGPSEKMPLQDVVVIGGGPAGVGSAIYSARKGLK
    VTLIADRIGGQVKDTMGIENLISVPKTTGPELSGALQAHLNDYDVTVKEHLRVTNIEQGDIKSITLSSGEVIDSKTLIIA
    TGAKWRELGIPGEKENIGNGVAY
    CPHCDGPFFKGKDVAVIGGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLVDQAE
    ARDNITILRNVATKEIHADNGKVSAIEYQDRVTEANHSLKLDGVFVQIGLVPNSKFLGDVVELTRFGEVVINEKCETSQP
    GIYACGDVTTVPYKQIVVAMGEGAKASLASFEYLLANSSRLDAMYQNHQTSQSAAA

    >gi|256821367|ref|YP_003145330.1| peroxiredoxin [Kangiella koreensis DSM 16069]
    MALINTEIKPFKATAFKNGEFVEVSNKDIEGKWAVFFFYPADFTFVCPTELGDLADHYEDLQSRGVEVFSVSTDTHFTHK
    AWHETSDTIGKINYAMIGDPTGEITRNFDVMREGQGLADRGTFVVDPDGVIQVMEITAEGVGRDAEELVRKIKAAQYVRN
    NPGQVCPAAWKEGEETLAPSLDLVGKI

    >gi|256821486|ref|YP_003145449.1| Protein-disulfide reductase [Kangiella koreensis DSM 16069]
    MKIGMNNLIQSFLLLLVSFLGLGFAPSTQAAQIDLNSLLGEEEELLRVDDAFVLQAEILDNTVLVKFEIAEGYYMYRERF
    GFQSDDATLGEPLIPEGLEKDDPYLGQTEVYYNFIEIAVPYSNATNPMALSIDFQGCAEDRLCYPPTTREVVLEVPASTL
    ALANTGTVAADGEPTAENGKKAFVSEQQSLIEDLEQKNAFWNFFKFILIGLGLTFTPCVFPMIPIISGIIAGQGKNITTR
    KAFGLALSYTQAMAIVYAILGVLVALAGQSLSGYLQNPVFVIGAAIVFVLLSLSMFGFYELQLPAGLQAKLAAKSNSQKS
    GSYIGSAIMGAISALIVSPCVTVPLIAILIYIAQSGDVVLGAASLYGLGVGMGIPLILIAVTEGRFLPKAGNWMNAIKAV
    FGVAMLAVALYLVKHLLPNSIYMYGWALLALIPGYYLFKNQLPNLGWRNLFAGLGLVLMIYGALLVIGGAQGNRNLLQPL
    GQSYSMMTTEYSQMAEGPAQAQSKSTLTNPSKPHLQFDRIKTLDQLEQRVAQANAQGQTVMVDFFAEW
    CAACYEFEELVF
    TDPAVHQALANTVLLQADVTANDKLDVELMNAFKILGLPSIIFFDLQGNELSQYRANGFEKADVFVRRIEAAFGL

    >gi|256821490|ref|YP_003145453.1| Redoxin domain protein [Kangiella koreensis DSM 16069]
    MRLNIPQLFPSLLLLAVSSLGSSIATANDAGQNNDLLEQLNLEQYHGKVVYVDFWASWCGPCRQSFPVMNELQKTYGEDN
    FVIIAINEDSEPGAAKQFLEQYPASFTIFYDQDGELAKYFKVDAMPTSYLLDQAGTAKYRHRGFHQKDVAKLEQQIETLL
    SAQSFNAGPSNTSNSGDTE

    >gi|256821565|ref|YP_003145528.1| glutathione S-transferase domain protein [Kangiella koreensis DSM 16069]
    MSALEQPILVSHKLCPFVQRSVITLLHKKIDFTIEYISLERKPDWFVEISPLGKVPLLRIKDTVLFESAVINEYLDETHG
    EPMLPKDPLEKAEHRSWIEFSSSINNIQFQLTQARREETFSKIEEDLNKKLAHLEKRIGDKGFFNGKEFSLVDSSFAPFL
    MRSKILAENTGVDTVSDYKKLQKWRENLLSLPEVKKSVVKDFEDLYMESIYERGGYLADQ

    >gi|256821629|ref|YP_003145592.1| peptide methionine sulfoxide reductase [Kangiella koreensis DSM 16069]
    MKNLLIFIITVLVVAGLAFVMMRAQSASLSKQPFVNKEKPENLEQDMPATKQVDTIVLGEGCFWGAEKRLEALPGVIDAE
    VGYADGRGHEPTYAEITKSKHKSNPDNYAEVVKVTFNPQQISLETIIKDYFESHDPTQLNRQGNDVGTQYRSTILTNSPE
    QAKVANRLKDEFQVLMSKAGYGKIVTVIKPLDQFHPAEEYHQDYLLKNPNGYCPDFSTGVTFDSKPESEKVDNSSLLSGK
    QIVIVDSQDYCPYCEKFKKDVANDYQGTIPMTFRYASQLDGLETKTPTWATPTILFIENGTETLGYQGYLSAKEFYKALG
    YFKLGDSEAFNVAFQKSTDGRFCKQYEIFKDTPDGVFVDKLSGQPLFDTRDRFNSGTGWLSFTKPVDGSVTYHEDNSFGM
    QRTELRSASTGIHLGHVFDDGPNGKRRY
    CINATVLEFVPREKL

    >gi|256821635|ref|YP_003145598.1| iron-sulfur cluster assembly accessory protein [Kangiella koreensis DSM 16069]
    MSITVTEAASRKVKQLIDEEQNDQLKLRVFVTGGGCSGFQYGFTFDEKQNDNDMAIEQDGVKILVDALSFQYLMGSEVDY
    TEGLQGSRFLISNPQAKTTCGCGSSFSL

    >gi|256821765|ref|YP_003145728.1| heavy metal translocating P-type ATPase [Kangiella koreensis DSM 16069]
    MDAKVRGECFHCGLPIPANYHQTLEVLNKEREFCCAGCYSVAETIVNNGLTDYYQFRTEQAIRPDQELPPELIAFDEEDI
    QAEYLVGENNNSATNDKSSSIILLSESIR
    CSACAWLIERTLRKLTGVTGAQVNVAAQTINLQWQPETIELSKILKRLHQL
    GYAALPYKPEQALAINIKQQKSWLRRLGMAGLGMMQVMMYAVGLYLGAWDDVNQQHGHFLRWVSFFIATPVLFYAGFPFY
    FSAIQSLRQFRLNMDVPITLALFLAYSASIWAVITQSGEVYFDSVTMFVFFLLIGRYLEFRARQQVSEKVYKGQNTLPVY
    AEKIDYEQSQGKMISLKKLQQSDEILIRPGATVPIDGELITEQAEVNEAMLNGEFLPRQKHQGQMVMAGSVNTHQAIRIK
    VTSNASNSYWTKLLSMQEAALLEKPKIGLLADTVARYFVLFILLLATVVAWYWLRHEPQEALWITLSVLVVSCPCALGLA
    TPIAMTCGALAHNQRNVLIKGQHFLQNTSHITDVIFDKTGTLTEGTFTVDKVELFADRSKEQVLAIIAALEVQSEHPIAL
    AFYEYQSKDVVANDIEHHSFAGVSGKIGGQQYWFGNRQFIESRGATIELPSDSGLWLYDGQHLIAHIVLTDKIRQQAKSM
    VEQLKDKGYRLHILSGDPSEQTEKVAKQLGIELWSHAMLPEQKLSYVKSLQTNGARVLMVGDGLNDAPVMSAADSSIAMA
    KASDLTRTTADAYLLSEKLLDIPFVLRKSRQTQSVIKQNISWALAYNTVMIPFAAMGYIPPYLAAIGMSLSSIVVVLNSL
    KLKRESKQAMS

    >gi|256821939|ref|YP_003145902.1| dihydrolipoamide dehydrogenase [Kangiella koreensis DSM 16069]
    MSNLHAQVVVLGSGPGGYNAAFRAADLGMDVILIEKYSVLGGVCLNVGCIPSKALLHTAKVIDEAEEVSAHGVNFGKPKF
    DIDKIREYKDGVVKQLTGGLAGMAKGRKVKVVEGYGKFTGANEIEVENDGKKQKVTFDNAIIAAGSRVVQLPFLPEDDRI
    VDSTGALELRQVPKHMLVIGGGIIGLEMATVYRALGAKITVVEMADQLVPAADKDVVKVLEKYVSAKYENILLETSVTKV
    EAKKDGLYVTFEGKNAPEKPQKFDMILSAVGRRPNGDLIDADKAGVKVSDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLA
    HKASAESHVAAEVIAGKKHYFDPLTIPSVAYTDPELAWVGLTEKEAKEQGIDYGVGKFPWAASGRAIGVNRKEGFTKLLF
    DKKNNRVIGGAIVGVNAGELIAEVGLAIEMGCDAEDIGLTIHAHPTLSESVSFAAEVYEGVCTDLPAQRKKK

    >gi|256821967|ref|YP_003145930.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MKQIKAVLILIITSLISVSAVALDRTKIVDDANHVTPLLIGQQVPDIHLWDTEGKPFRLLEKVKQKPTILLFYRGGWCPF
    CNAQLSQIQEIESELVEMGYQLLAVSPDTPDELVQTSETRNLSYELVSDFQLAATRGFGLAFHIDDGYAGKIEELGGKAA
    KAEGDSQSTLPVPAVFILDKQGMIQFEYINPNYKVRIESELLLAAAKVALGQNK

    >gi|256821987|ref|YP_003145950.1| Peroxiredoxin [Kangiella koreensis DSM 16069]
    MSTIYEYSAILNNGQEVSLEQYKGKVLLIVNTASACGFTPQYEGLQKLYEEYKGQGFEVLAFPCNQFNNQEKGSDEEIKD
    FCDLNFHINFPLFKKIDVNGDDAHPLYQYLKSKAPGLLGSKAIKWNFTKFLISKDGQVITRFATATKPEALAEPIKDALN
    A

    >gi|256822058|ref|YP_003146021.1| disulfide bond isomerase, periplasmic; chaperone; activated by DsbD; homodimeric [Kangiella koreensis DSM 16069]
    MKNLLIILMLSLTIPLASAATKALSEEEVKVMLEARFPGASIDHVSPSEVDSLYSFMLQGDLYYVSNDGKYLIDGKMLDI
    STEQIRNISQERISQLDQMKSPMRKREMAKLKDEDMVIFKAPNEEHVISVFTDID
    CGYCQKMHRERDDYLSRGITIRYLA
    FPRAGLKSKSADKLQGIWCAKDQQTAMTEAKLERKYREGSCTTPFAEHMSLVRKFGIRGTPGIILENGDLVGGYLPAEIM
    RQRLDQLKKDTK

    >gi|256822163|ref|YP_003146126.1| electron transport complex, RnfABCDGE type, E subunit [Kangiella koreensis DSM 16069]
    MINSEHKTIIKNGLWDNNPALVQLLGLCPLLAVSNTFINGLALGLATTWVLAGSNGSVSLVRNYIPKEIRIPIFVMMIAS
    FVTNVGLIMNAYTYDLYLTLGIFIPLIVTN
    CAIIGRAEAFASKNKFVPSLLDGVMQGFGFTAVLCTLGALREMIGQGTLF
    SGAEQLFGEWASDLTISFYLTDSTFLFAILPPGAFVGLGILIAIKNGIDHKRAEQAKASKASPVQSGEALSHE

    >gi|256822168|ref|YP_003146131.1| electron transport complex, RnfABCDGE type, A subunit [Kangiella koreensis DSM 16069]
    MGEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSGKLETAIGMSVATTFVLTLASALSYIVNTFILAPLGMEYLQTLSFILV
    IAVMVQLTEMIIHKTSPILYRLLGIFLPLITTN
    CAVLGVALLNVNEAHNFVQSVIYGFGAAVGFSLVLVLFAAMRERLAA
    ADVPLPFKGASIAMITAGLMSLAFMGFSGLVKL

    >gi|256822209|ref|YP_003146172.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Kangiella koreensis DSM 16069]
    MGNKKILITSIPIIIFTALVIVFWFSLGSDPTELPSQRIGKQVPEFRLSNLHNPEEAFTNKDLPNKPFLLNVWATWCVSC
    HVEHPYLVKFANQYPIPIIGLNYKDVRVDALQYLQKGGDPYLFSIADEDGTMGIDLGVYGAPETFIVDGDGVIHHRYVGV
    IDERVWNTVILPKMKELDPSLAKVEVTQ

    >gi|256822335|ref|YP_003146298.1| thioredoxin reductase [Kangiella koreensis DSM 16069]
    MSETRHFKCLILGSGPAGYSAAVYAARANLNPAIITGIQQGGQLTTTTDVDNWPGDNEGVQGPELMVRMQKHAERFGTEM
    IFDHIHTVELKNRPFTLTGDSGTYTCDALIICTGASAKYLGLPSEEAFMGKGVSA
    CATCDGFFYRQQKVAVIGGGNTAVE
    EALYLSNIASEVHLVHRRDELRSEKILQDKLFEKAKNGNVVLHWHRTLEEIVGDDMGVTGIRIKSTQDDSIEELELQGVF
    IAIGHKPNTDIFEGQLEMKDGYIVVKSGLAGNATATSVEGVFAAGDVCDHVYRQAVTSAGTGCMAALDAEKYLDQ

    >gi|256822348|ref|YP_003146311.1| Rhodanese domain protein [Kangiella koreensis DSM 16069]
    MKAFRLVCLLSITYFIASCASTPTVESGDSTTDKLLAKEYLVSVGDKVSFKDSTIEFLDIVNDSRCPKGVQCVAEGDATL
    SFIYSTPSSAESFNLNTSDSSIGDFNGMKIGLMSFDPLPSEGNILSPKEFKARLVVTEEGALDDVTIIDVRTDGEYNNSH
    YSGAVNIPVDEIGSRISQLNLANEQTFVVY
    CRSGNRAAKAKDELEAMGYTSVINGVNEDSLDKLLD

    >gi|256822400|ref|YP_003146363.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MNTLMKQFLLALLVTFSFSATAESGWVGALAPDFKLQDQNEEWRSLEDYKGQWLVLYFYPKDDTPGCTTEAKNFRDGYKD
    IKALNAEVVGISLDDVESHKSFAEIHDLPFSLLADVDKEAATAYDVLGGFGPVEYAKRQTFVIDPNGNIVYHYDDVEPDT
    HMTDVVAKLKELQKGLAE

    >gi|256822448|ref|YP_003146411.1| UBA/THIF-type NAD/FAD binding protein [Kangiella koreensis DSM 16069]
    MLTQKELIHYSRHIILPEVDEVGQSKLKESTVLIVGMGGLGSPVAMYLAAAGVGNLILSDHDAVEQSNLQRQIVHSLESI
    GDPKVSSAKTTLENLNPWIKITTIEQHLDGKVLDDAVANANLVVDCSDNYATRFALNESCVQHSKTLVSGTAIRFKGQVA
    VFNQTPGSACYHCLYQADQFNDES
    CEDQGILAPVVGVIGSLQATEVLKTLMGIGKTLDSRLLVYDGLNASFKDMKITKDP
    ACEVCGL

    >gi|256822492|ref|YP_003146455.1| mercuric reductase [Kangiella koreensis DSM 16069]
    MRKFSISGMTCERCPQQIEDALIVMPGVRNATVFYTKSSAVVEAESDVNEQTLINTIKALGYTAQPVALDGCDSEDVTDK
    KSLHVAIIGTGSAAFACAIKAVENGAQVTLVEAGDVIGGC
    CVNVGCVPSKILLRAAQLAEQQRNNPFDGLENHEPSLDRS
    LLAKQQTARVEELRAAKYQHILDTNPALSLVQGYASFKDTHTLTIRNKDGYEQELVADRFLIASGSQPSIPPIPGLVDTP
    YWTSTEALFETELPEHLLVIGSSVVAVELAQAYRRLGAEVTILARSTLLLREDPLLGEGLTVAFEQEGIRVLEHTQASQV
    SYEDNKFILDTEQGEIRGDKLLVATGRAPNTGKLNLAAAGVEKEANGAVTVGDQMRTSQSHIYAAGDCSNMPQLVYVAAA
    AGSRAGINMTGGEARLNLSAMPAVIFTEPQVATVGLSEQEAHAQNIETESRVLPLENVPRALANFDSQGFIKLVVEAGSQ
    RLIGAQVLAHDGGEIIQSAALAIHNHMTVDDLADQLFPYLTMVEGLKLCAQTFSKDIKELSCCAG

    >gi|256822493|ref|YP_003146456.1| mercuric transport protein periplasmic component [Kangiella koreensis DSM 16069]
    MKKIALLSLLSILSLGAFAKQQTVMLEVPTMTCVTCPITVEKALQQVEGVTKAEVTFEDKLAVVTFDDEKTTVEKLTEAT
    KNAGYPSVVKQ

    >gi|256822525|ref|YP_003146488.1| copper-translocating P-type ATPase [Kangiella koreensis DSM 16069]
    MKEHRQENISSFVTVKSEEQGAQVGMLELLVEGASCGSCVRKIERALLAIPGVESAEMNFAQRTVSVTGNVEASALIKAV
    EKAGYNAKLTAIESEDDALKEKEKADQVYYKRLVKETWIALSLGIPLMAYALITGEVNVNTTTERIAWLIVGILTFGVLY
    FSGKHFFVGAWKSFLNHSANMDTLIALGTGTAWLYSMVVVFFPGSVPDQARHVYFEATAIIIGLIDLGLALEIKARGRTS
    DAIKRLIGLQAKTARVVRDGKELDIAIDQVLIDDVVRVRPGEKIPVDGEVIEGHTAIDESMLTGEPMPVEKSQGDTIAAG
    TINKSGSILFKATRVGKDTALAQIINMVKRAQNSKPPIGRLADVISAYFVPVVMIIAVISALTWLNFGPEPAVAFAIVSA
    TTVLIIACPCALGLATPMSVMVGVGKAAEAGVLIRNGEALQMASKISAMVLDKTGTITLGAPKVTDVLVAGEHDQQSVLR
    LAATLESGSEHPLAMAIVESAKDRGIETGKVSNFNAIAGHGVQAEVEGKTLLFGNEKLMHERNIYLGTFIEKAQSLASDA
    KTPMYFAVDNQLAAIIAVADPIKEDSIAAIKRLQHNGIRVVMLTGDNRATAKAVAEKAGIKEFFAEVLPEEKSKKVQELQ
    MEGEVVGMTGDGINDAPALAIANVGFAIGTGTDVAIESADITLMRGSLHGLADAIAVSKATLRNIKQNLFGAFIYNVAGV
    PFAAGVLYPFLGMLLNPVIAGAAMAFSSLTVVTNANRLRLFKAQEH

    >gi|256822542|ref|YP_003146505.1| hypothetical protein Kkor_1323 [Kangiella koreensis DSM 16069]
    MTKNTTENKETRLTWFALFSTMGTLVCCALPIALVTLGMGATVASLVSSMPFLVTLSEHKIWVFVISGALLAFSAWMIYR
    PRRNCSTDPELGVLCNKSQRWNRRIFWLSIILWCAGFLAAFLALPLQIWLER

    >gi|256822543|ref|YP_003146506.1| Heavy metal transport/detoxification protein [Kangiella koreensis DSM 16069]
    MSFLVVFSALVWSASAFSASKHYQIRVDGLACPYCAYGIEKKLMKIDGVTHVDIDLKKGLVIVVGNETLVLKDSQLKTLF
    NDAGFTFRKIEKVELINNQ

    >gi|256822568|ref|YP_003146531.1| UBA/THIF-type NAD/FAD binding protein [Kangiella koreensis DSM 16069]
    MLTEQELIHYSRHIILPQIDEAGQEKIKQSKVLVVGMGGLGAPVAMYLAAAGVGHLYIADHDQVERSNLQRQIIHNLNSI
    GQNKVDSAQSTLKALNPWIQVTSIKQKLGDQELDDLLSKVDAVIDCCDNFKTRFAINRAAVKHQKPLVSGAAIRFEGQLA
    VFNYTDQSPCYQCLYQPDIQLDEN
    CFDQGVLSPVVGTIGTLQATEALKIITAAGQVADGRLLIYDALNGDFRKIKVTKDA
    NCAICGA

    >gi|256822574|ref|YP_003146537.1| copper-translocating P-type ATPase [Kangiella koreensis DSM 16069]
    MSNNSSNHKTVELTIEGAGCASCVGKIEGALKNVSGVESAEMNFADRTVMIKGSASTDSMLQAVDNAGYKASVIENESES
    DALEEKEQASKAYYKRLMTQMWIALLVGVPLMAYGLLGGAMTVHTTNERIVWSIVGLITLAIMYFSGKHFYTGAWKSFKN
    HSANMDTLIALGTGTAWVYSMVVVFFPDSIPEMARHVYFEATAMIIGLINLGLALEVRARGRTSEAIKRLIGLQAKTARV
    IRDGDELDIPIEDVQKDDLVRVRPGEKIPVDGVVTEGKSSIDESMLTGEPMPVEKGEGDDVSAGTINKSGSIIFKATRVG
    KDTALAQIIKMVKQAQNSKPPIGRLADVIAAYFVPTVMIIAVISALVWLNLGAQNGLAFAVVSATTVLIIACPCALGLAT
    PMSVMVGVGKAAEAGVLIRNGESLQTASKITAMVLDKTGTITEGSPKVTDIVSFNDLSDDENLKLAASLETGSEHPLAQS
    IVESAKEKDIELSKSSDFNAIAGHGVEGNVDGKHLYFGNEKLMRDQGIDIDHAVDKAQELAGEAKTPMYFAIDKKLAAII
    AVADPIKDDSIEAIKRLQKSGIRVVMLTGDNKATAKAVANKVGIEEFFAEVLPEDKVNKVKELQQEGELVGMTGDGINDA
    PALAQADVGFAIGTGTDVAIESADITLMRGSLHGLADAVATSKATLRNIKQNLFGAFIYNVAGIPIAAGLLYPFFGILLS
    PVIAGAAMAFSSVTVVTNANRLRFFKPKEH

    >gi|256822687|ref|YP_003146650.1| carboxymuconolactone decarboxylase [Kangiella koreensis DSM 16069]
    MAHLKPLPADSHPELASDFKIFEEILGFIPNSLLTMQRRPKMVQAFGVLTKAVMDPEGEVDLGFKRLIAHFASRAAGCQY
    CEAHSLIAANIHGISQEKLDAIWEYQTSSLYSDAERVALDYALAAGSVPNAVDDELMIRMKQYWSEEQIVEILGAVCLYG
    FLNRWNDSMATDLEDSPKQMGDRVLTKGGWTGGKHTR

    >gi|256822688|ref|YP_003146651.1| peptide methionine sulfoxide reductase [Kangiella koreensis DSM 16069]
    MNHHVFHKTIMTQPEAGQEIATFALGCFWGAEKLFWQQDGVVMTSVGYAGSDFENPSYEQVCAGVTGHAEAVQIIYDPSV
    ISYQDLLQLFWENHDPTQGMRQGNDIGTQYRSVILAHDLTQQELAETSREEYQKLLSAKGYPSITTEIEAFKTYYLAEEY
    HQQYLSKNPAGYCGHGGTGVCFIQN

    >gi|256822721|ref|YP_003146684.1| iron-sulfur cluster assembly protein IscA [Kangiella koreensis DSM 16069]
    MAITLSDAAAERVKSFLANRGKGLGVRLGVKTTGCSGLAYVLEFVDELNEDDVVFEDKGVKVIVDPKSSLYLDGTRLEFI
    KEGLNEGFEFVNPNVKGECGCGESFTV

    >gi|256822784|ref|YP_003146747.1| hypothetical protein Kkor_1567 [Kangiella koreensis DSM 16069]
    MGMELVYIVLVILCLISAINFKLTLNLLKIIRDSSSTIDEISPVHIGEKVPDIKGRRISSNDYEGLNITGAPSVLLFVSS
    Q
    CPKCQEKIPQIEYLHPLMRELGICISIISKESTVIMKSFLNNSILLDNVWFVSNKNYKKLNPTFASPFYLFISHEAKLQ
    AYGFIGDSDWESFAEQVKGGRDSEAVA

    >gi|256822793|ref|YP_003146756.1| sulfur relay protein TusD/DsrE [Kangiella koreensis DSM 16069]
    MATYSLLVTASPYSSQGQLSAIQFAKTLLEQGHELMRVFFYADGVLVASRLHAPPADEINLTKAWAKLAIEKDIELIACV
    TAANKRGIVNVAEAERNALTGNNLDPAFEISGLGQLTEAMLNSDRLVTFG

    >gi|256822798|ref|YP_003146761.1| Redoxin domain protein [Kangiella koreensis DSM 16069]
    MIGIGDALPNVTLKVMGKDGPQDISTDDIFSGKKVVLFAVPGAFTPTCSAAHLPGFVVQADDIKSKGVDTIACMSVNDVF
    VMDAWGKAQNADEIMMLADGNADFTEAMGIEMDATGFGMGVRSKRFAMIVDDGVVKALEVDEKGFEKSSAENILSKL

    >gi|256822845|ref|YP_003146808.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MSQPQLNKKAPNFKLPATGDQTLSLADFKGKNLVIYFYPKDNTPGCTTEGQDFRDHYKQFQKHNTDILGVSRDSVRTHEN
    FRKKHEFPFDLLSDADEEMCKAFDVIKLKKLYGREYMGIERSTFLIDSQGKLKQEWRKVKVKGHVEEVLETVKAL

    >gi|256822850|ref|YP_003146813.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MIIMRHLCLRFILSAFLLLLVVSCDTSKEFSLLSGEQKNLSDYEGSWLVVNFWAEWCPPCLEEIPELNLLAQENGNIQVL
    GVSFDRLPNEELIALTDKLDIQYPVVATEPMPFLPMERPQSLPASYIVTPKGEVMGPLLGKVDRHKIIELIEKIKTAQ

    >gi|256822853|ref|YP_003146816.1| arsenate reductase [Kangiella koreensis DSM 16069]
    MSEINILHNPRCSKSRQTLALLQENGVEPNVIEYLKTPPSKTKLKQIVKLLGVSPRDIIRTKEAEYKEAGLDNPDLTKEQ
    IIELMVSNPKVIERPIVFSNDKAAVGRPPENVLAVLK

    >gi|256822897|ref|YP_003146860.1| alkylhydroperoxidase like protein, AhpD family [Kangiella koreensis DSM 16069]
    MTHPFEEFRHKREQGNAKALDTDSLLIKRFFGLDKTAYGEGTLDSKTKELLGLVASMVLRCNDCIDYHLEQCVKQGWNKQ
    ELDEAMGVAMLVGGSIVIPHLRHAKLSLEFLFEEQAQSD

    >gi|256822954|ref|YP_003146917.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MGVLVGRKAPDFTAAAVLGNGEIVEDFNFAETTKGKPTVVFFYPLDFTFVCPSELIAFDHRLEEFKKRGVEVIGVSIDSH
    FTHNAWRNTDINNGGIGQVGYTLVADVKHEICQAFDVEHPEAGVAFRGSFLIDKDGVVRHQVVNDLPLGRNVDELIRMVD
    ALQFHEEHGEVCPAGWNKGDKGMDATPEGVAKYLSESADKL

    >gi|256822961|ref|YP_003146924.1| glutaredoxin-like protein [Kangiella koreensis DSM 16069]
    MSDTIEQIKQQIADNKVLIYMKGSPKLPMCGFSAQAVQALMQCGHEFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    LGGCDIILEMFQQGELQEALNESYGTQPE

    >gi|256822992|ref|YP_003146955.1| OsmC family protein [Kangiella koreensis DSM 16069]
    MLEDSVHKATVTNTLEDGLFCNIDADGHKLVGDEPEERGGHDKGPTPYHYLATALGTCTVMTLNMYANRKKWPVDQIKVD
    VIHKKIKAEDCEDCETEKGFVDVLERQIKVTGDLDREQQERMLEIANKCPVHRTLMGELKIRSKLVCKVG

    >gi|256823097|ref|YP_003147060.1| methylated-DNA/protein-cysteinemethyltransferase [Kangiella koreensis DSM 16069]
    MKTQIYYQQSSCPFGTVHIYANEHHLKAVLFKPWDKIATNDLINKSNDIVEQTRHQLQEYFQGKRQEFDLPLKADGTDFQ
    QTVWQALCKIPFGETWNYGQLAQAIGNKNASRAVGAANGKNPISIIVP
    CHRVIGANGTLTGYAGGLTIKEWLLKHEGIIE


    >gi|256823138|ref|YP_003147101.1| arsenate reductase and related [Kangiella koreensis DSM 16069]
    MSKAVTIYGIPNCDTVRKAVKWLEANDIKHEFVDYRKNPLPRKEIESWDKAIGWETFLNKRSTAWKPLDQSVKDNIDRDS
    ALDLMLEKVTLIKRPVLVLKDGSNIDVHLSFKPEQYQAIFN

    >gi|256823282|ref|YP_003147245.1| methionine-R-sulfoxide reductase [Kangiella koreensis DSM 16069]
    MKFTVSILGAGAIGQLLAHKLTDASVECQLIVSDSDKYDSPDWQFRDLNQKVSSQQLQSTAHSSSRKDSSPLVLVFVCVK
    APQLESALDSIKHRLHDQSQLVLFQNGMGHENVASHYVSEQNIFFASNTHGAYRESSQSLVYAGAGKIIVGAFEQQSTPE
    WFNQLQQTSTGLTFEWSADIQPILWRKLLINAVVNPLTAIHRCKNGELLKEEYRTQLLALINESRQFAQAMQFDFADDLK
    TIILEVIEQTADNYSSMYQDAMAERMTEINAINGYLLDQIQAKAFHAPHHWALWSQFHIQYPPLKKLTETKAKNFDEVTY
    HVTQEHGTERPFTGQYNMHQEKGVYRCVCCNSVLFDDSGKFDSGCGWPSFDRAQNNKAIAYLVDTSHNMQRVEIRCAQCG
    SHLGHVFNDGPTDTGQRY
    CVNSVSLDFEPADH

    >gi|256823509|ref|YP_003147472.1| glutaredoxin 3 [Kangiella koreensis DSM 16069]
    MSQVTIYTTRYCPFCVRAKSLLNELQVDFKEIPVDGDAELRAHMESLTGGYTVPQIIINERAIGGCDDLYALHRKGELLP
    LLQDNNE

    >gi|256823510|ref|YP_003147473.1| Rhodanese domain protein [Kangiella koreensis DSM 16069]
    MQQLLEFYGNHPVLGTAWLAFTVLIIISLIKTATSGSKSLTPLMMTQMVNKQNAVVVDLRAIADFNKGHIPGSMNIPFGK
    LKDRIKDLEKHKGTPIIMV
    CNAGVQAGNATMQLRKHGFTEVHKLKGGIQSWTTENLPLAKG

    >gi|256823537|ref|YP_003147500.1| Disulphide bond formation protein DsbB [Kangiella koreensis DSM 16069]
    MNLNNRGWNFLGAFICYQLLVTALYFQYVDGLEPCPLCMFQRVAVAAMGIVLLLNAIHNPTIHSISNRIYQILGLLTALV
    GIGISGRHVYLQSLPEGEAPA
    CGAPLDYMMDILPFMEVIQTVLTGAGECAKISWRFWGISMPGWMLIIFIIAALVFSFRL
    FKAFQQPKPL

    >gi|256823561|ref|YP_003147524.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Kangiella koreensis DSM 16069]
    MLEVVTCPINLLTLSAFKESLLKQLLFSSISILFLAGCASIQAPSSSDTQPVTTKPKYETYVQVGQLMPLKTVTTIDGKS
    IDLTNPEKRKLVILFATW
    CSDSQRAMKALHESDILNQEDLQIVAIARENTVEEIKKFRQERNITIDLVADVDRSIYKQFA
    SAGIPRFILVDKNNRIVNEVLAEGENQIELIQW

    >gi|256823571|ref|YP_003147534.1| NADH:ubiquinone oxidoreductase, subunit D [Kangiella koreensis DSM 16069]
    MAFDKQEAKSVLLSPIFNNNPIALQVLGICSALAVTSKLETALVMSLALTTVVAFSNLLISLIRKQIPSSIRIIVQMTII
    ASLVILVDQVLKAYAYEVSKQLSVFVGLIITN
    CIVMGRAEAYAMKNGPAMSFLDGLGNGLGYSVLLIIVGIIRELFGSGK
    LLDFTIFPTIADGGWYHTNGMLLLPASSFFIIGLLIWALRTWKTDQVEDAE

    >gi|256823572|ref|YP_003147535.1| NADH:ubiquinone oxidoreductase, subunit E [Kangiella koreensis DSM 16069]
    MDHYISLFAKAVFVENIALAFLLGMCTFLAVSKKVQTAMGLGIAVVIVQAITVPVNNLLLNGLLKDGALAWAGFPEADLS
    FLGLIVYIGVIAALVQILEMTLDKFFPALYQSLGIFLPLITVN
    CAILGGSLFMVERDYNFPESIVYGFGSGFGWALAIVA
    LAGIREKMKYSDVPDGLRGLGITFITVGLMALGFMSFSGIKL

    >gi|256823700|ref|YP_003147663.1| protein of unknown function DUF255 [Kangiella koreensis DSM 16069]
    MTQQSAGKNNLQDATSPYLQQHKDNPVHWQQWNQQTLELAKQLDKPILLSVGYSSCHWCHVMAHESFEDAATAEVMNQLF
    INIKLDREERPDLDKTYQLAHQLLNRQAGGWPLTTFLDPQTLTPFFSGTYFPKQPKYGMPAFTDLLNNIAGVFSEKRDEI
    KQQNGQIQEALRFISGSAGQQAENNATTSSASLSQAFIEEVLKRSDQDFGGLKGAPKFPQAAIWQAAFELLIDEDGQQQA
    LSEHLSKTLHAFADYGLYDHLGGGFFRYCVDEYWDIPHFEKMLYDNGQLIKLMAEAGNYYAQGDWMQRVKQSISWLTEQM
    QSEQATYYSALDADSLNADGHSEEGAYYVWQQSDIQSMNEQEQAVAKAYYGFADKPNFEGHWHLVCRNSLKQVSEQTGIH
    PKQLPLLIESVRQQLKAERDQRPLPFLDDKQLTSWNGLLLQGLFSAARQLGDDAILQQAKDCQLGLYQTVWSGTELKACY
    RKGQAYQSAFLDDYAYFAKALLMRLTFDFDEQSWHWLLDLCDGLWTKFADKRQGGFFYTAEDAEMVITRHKSWSDDAMPN
    SACQALEVLWLVGELTGKMEWLEFIEISLQQASAEAIKAPLQYPSVVRVLNAYEKGSEVWVLRGDLHQTVGWQEYLSTGQ
    YSQRWVFSLESNSDLLKDKYPAQEKAVAYCCRNRQCFPALESFDAIQTFLQAE

    >gi|256823702|ref|YP_003147665.1| hypothetical protein Kkor_2488 [Kangiella koreensis DSM 16069]
    MKHFLLVSGLVFLLGANVDTVHAIEQGQDYWRITLTDESQLNTQDNLYFSWLGCTSCRMLEQELASELDELEYVPLIARP
    EWRAAAKLHYVMQLLELSDEQKNNMITKIDAGEIDVTDFNAMQEELLAMEVDEEVLTLLLENKELYRKVQRAEDLAAKYR
    IQYAPTVVIKGQFATDANHTMKIDRFAEVLRYLKSL

    >gi|256823761|ref|YP_003147724.1| glutathione-disulfide reductase [Kangiella koreensis DSM 16069]
    MSNNIKHYDFLAIGAGSGGIASANRAAIRGAKAAVIEAQAVGGTCVNLGCVPKKVMWYGAHIAEAIKYSEAYGFDLEQTG
    FDWARLVQNREAYIERIHGAYHRGFESNGVDFIEGYARFVDKNTVEVNGEQITADHIVIAVGGRPIIPDVPGAELGIESD
    GFFALTERPKKAVVIGAGYIAVEIAGVLHALGSNAHLLVRKDRPLRYFDKDLTDALLDRMELDGPVLHTHTDVSKIEKDD
    QGLLEVHTSKGECIDNVDCVIWAIGREPATDDIGLEAAGIEMDGEGFIRTDKFQNTNVEGVYAVGDITGEAQLTPVAIKA
    GRLLAERLFNPEMPNVHMDYSQIPTIVFSHPPIGSLGLSESDAVEQYGADDVKVYKSQFAAMYNAVTPHRALSTFKLVCQ
    GENEKVVGIHGIGEGMDEILQGFAVAMKMGATKADFDATVAIHPTSAEEFVTLR

    >gi|256823807|ref|YP_003147770.1| thioredoxin [Kangiella koreensis DSM 16069]
    MSDKIVYLTDATFEAEVLNSDQPVLVDYWAEWCGPCKMIAPILNEVAEMYEGKVKVAKLNIDENSETPPKYGIRGIPTLM
    LFKGGNIEATKVGALSKSQLMAFIDSNV

    >gi|256823827|ref|YP_003147790.1| Redoxin domain protein [Kangiella koreensis DSM 16069]
    MMSLSIGPISLPFDRLLLLICLAIAFIVGAVAAKKDKTSVDGRIAGIFIIALIAARISFVIQYWQEFQGNVWAMMDIRDG
    GFDGLTAIVIGFIALIGFVWKQAKGRQAMLKGVMAGVTVWGLTTVSLWAIKDTSQQLPHIMVKQLGGSTVNLSEVEHGKP
    RVINLWATW
    CPPCRREMPVLEEAQQTMDDIGFVFVNQGEHSAIIEQYLQQETLLLDNVLADTAGSLGYQVGSRALPTTLF
    VNGQGQLVDAHLGELSKASLKAKLKKLIDKEQENTN

    >gi|256823837|ref|YP_003147800.1| DSBA oxidoreductase [Kangiella koreensis DSM 16069]
    MKLKTLFSAALALLALTQVACAEATSASQAKEGKDFSVISGAKGVSKPEVMEFFSYTCPHCYNVEGFLHKWEPTKPAEVS
    FKQVPVFLPQVAHLTYGYYTAEVLGVLDKVHPAIFNQWHAQKKIVKSKEELVPIFEAAGVTKEEFEKAYSSFAVENKVQH
    AKKLAREFKVSSFPMFVVNQKYKIESYEKLDYMLSKFPIEQAQ

    >gi|256822878|ref|YP_003146841.1| hydroxymethylbutenyl pyrophosphate reductase [Kangiella koreensis DSM 16069]
    MDIVLANPRGFCAGVDRAIEIVNRAIEIFGAPIYVKHEVVHNKFVVDGLREKGAVFIEDLNDVPENATLIFSAHGVSQQV
    RHEAKERNLKVFDAT
    CPLVTKVHMEVSRHSRRNEECVLIGHKGHPEVEGTMGQYDNTGAGIYLVEDEQDVAQLEVNDANS
    LFYVTQTTLSVDDTQRLVKALQAKFPNIQGPKKDDICYATQNRQDAVKQLAAECDLILVVGAQNSSNSSRLQELAENQGC
    RSYLINNATEIDSSWLNGVNKVGVTAGASAPEILVQDVIKYLESQGGSTAFESEGVEESIVFVLPAELRTE