Jonesia denitrificans DSM 20603 uid59053

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256831273|ref|YP_003160000.1| DSBA oxidoreductase [Jonesia denitrificans DSM 20603]
    MPHGPSTPTPEPNPEPTTPGPEVAANTTHPDGAVPATGAGASVSTSAPQSWLVPAFIVLTVIALIVLVLAIQPSTTNQAD
    PQQPPVGTEQSTDTADQDTQGDTDAVEPPADVQGPDEVNIADIERRDPNDPLAVGPVDAPVVMVVFSDYQ
    CPYCAKWSND
    TLTVLENYVDAGDLRVEWRDVNIFGENSERAARASYAAGQQGQFLAYHHALFPGGEISSEQVLSEDGLIALAGDLGLDTD
    QFTKDLTSKDTAEEVAKNAQLGLDLGAYSTPAFLVGGQPIVGAQPTDVFTSAIDTALQG

    >gi|256831324|ref|YP_003160051.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Jonesia denitrificans DSM 20603]
    MSENVDVVVIGMGPGGEVVAGELAKANRRVVVIERELIGGECAYYACIPSKVVLRAPALGQEVDHAAGITDARLSWEKTR
    TYRDQMARHWDDSTQVDSYEGQGVTVVKGEGRIVKPGVVAVGGREFVADHIVIATGTQAHIPAVDGLDTVPVWTTRELYT
    AQDLPDSAVIVGGSAVAVEAATFLARFGVNVTVVHRGSRILSREEPQVSDLVGRHLEEAGVEVKVNVEPAAVERSDTGRS
    VIHLNDGTALHTDVIVFATGRTPRTGTLGADTAGVTLGDRGQILVDDQCHAAPGVWAVGDVTGIMPYTHVAKYQGRIVAD
    AILGRPRRATYTAIPRVVFGDPEIAAVGLTAQQARDQGINSVENALDLTEALAKPWLDAQTPHGVLGVVADADNRVLVGA
    WAVGLHASEWIHWAAFAIRTRTPVDVLLDQVVQFPTYHEAYLSVIGGLDLR

    >gi|256831325|ref|YP_003160052.1| transferase, putative [Jonesia denitrificans DSM 20603]
    MVERETKSIHTTPGKYVEPGQDYDRDTQYIEDRITTDARDGWPVEAGRYRLIAARACPWANRAIIVRRLLGLEDAISLGT
    PGPVHDERSWTFDLDPDGVDPVLGIERLQDAYFARFRDYPRGITVPAIVDVPTGAVVTNNFPQITLDFSTQWTQFHRDGA
    PDLYPEALRSEIDEVAELIYQDVNNGVYRAGFAGSQRSYERAYTTLFSRLDWLEDRLSTQRFLVGDTITEADVRLFTTLV
    RFDAVYHGHFKCNRNKLSELPALWGYARDLFQTPGFGDTIDFQQIKDHYYQVHRDINPSGIVPLGPDASAWLTEHGREEL
    GGRPFGDGTPPAPPRDGEKVPSIR

    >gi|256831376|ref|YP_003160103.1| thioredoxin [Jonesia denitrificans DSM 20603]
    MATVEITADNFRDHVSDKGIVLLDFWAAWCGPCQRFGPIFEKASEKHPDITFGKIDTDAQQELAAGFGITSIPTLYAFRD
    GVIVYSEPGAINGKQLDSLIEQIEALDMEKIHADIAEQQANAAS

    >gi|256831406|ref|YP_003160133.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Jonesia denitrificans DSM 20603]
    MPTNTQASTTNRIVVVGGVAGGMSAAARARRIAENADIIVLERGGEVSFANCGLPYYVSGEITDAAKLQVQTPQSLGASL
    NLDVRTHSNVTHLDPANNTVTVQHTNTDTGNTNTYTLTYDALILSPGGVAITPPIDGINSPRVRTLRTVPDAIAMRDTVD
    QGAKRAVVLGAGFIGLEAAEALEAQGLDVHVVELADHVLPPLDTEIAHIVTGELTRLGMHLHTGVAAQAIEHHTDHDTVI
    LADGTRIDTDLIVLSVGVRPDTAVFQDAGLDTDRGAIIINNHGQTNLPHVWAVGDATLSTDAVTGIRRPIALAGPANRAG
    RLVADHIINPDTARELPHPVGTAIVRVGEYGVAMTGASRTVLTDANIAFHSVYLHPLNHAGYFPGAEAISLVVHFAQEDG
    RILGAQAAGKDGADKRIDVLATAIRAGMTIEDLIDLDLAYSPPFGQAKDPVNLAGMNGANVLSGKIRLWYPWQLHEMRET
    ALILDVRGPGEYATGHVPDALNIAHTELRDRLEEVRDAAAGRPVRIY
    CHSGMRSYLAHRVLDQAGFDSATLSGGMLTLKA
    HLGEHADDVLVTDTK

    >gi|256831539|ref|YP_003160266.1| methylated-DNA/protein-cysteine methyltransferase [Jonesia denitrificans DSM 20603]
    MDWTTCDTPVGPLLIVATHHGVARIAFITNDDATRELHRTAGMLTLSDYTVPDTDTWRQGAGYAHQAATELSEYFTGKRH
    TFDVPLDRRLSRGFRLAALTSISTIPYGTTQSYGEVASAINNPNAVRAVGGACATNPIPIIVP
    CHRVVRADRSLGGYLGG
    QGTANLSYKITLLDLEKADHNGSHLTLIDSTPVTSG

    >gi|256831581|ref|YP_003160308.1| OsmC family protein [Jonesia denitrificans DSM 20603]
    MSDPKYVTSATSWGGGRVGRVATQDQKIDLELSVPAGLGGDDGPGSNPEQLFAAAWASCFHGAVKAIARSRKVDVGESAV
    TVEVALNGEFDSGFFFTVVIEGEFPGVDDKEAHELLAAAHEK
    CPYSRVTRGNAEVELRVVS

    >gi|256831682|ref|YP_003160409.1| hypothetical protein Jden_0441 [Jonesia denitrificans DSM 20603]
    MSSLTIQLTAGARDPERAAQAVTVAAAAVVSGVEVSLWLSGDAVSFATVDGGGVVFPPAYSPWAELGPLLFDAAQVSVCV
    QSLSTHGVDAADLAPGVRVAGAASLVSEIIAPDTRVLVY

    >gi|256831761|ref|YP_003160488.1| Redoxin domain protein [Jonesia denitrificans DSM 20603]
    MASPALFTPMKRPVIAVLLALATASGVVGCAQESGNSTDVVQQGYQSGDGSITTWDPADRPGPVVLEGVSMTGDQVTTEQ
    WQGQIVVLNTWYAA
    CPPCRAEADDLVAVASARADDGVQFLGINRHDDTGTAAAFEREHGVTWPSLHDVDGAATAALSGVV
    PVKAVPTTVIVDEQGRVAARVLGEVSEATLNGLIDDVRAASGVDAP

    >gi|256831856|ref|YP_003160583.1| Rhodanese domain protein [Jonesia denitrificans DSM 20603]
    MAINKIILFYAFAPVADPTAVRLWQLALAEKYGLTGRVIVAPSGINATLGGRLEDLKQYVKTTRQYPGFGSMDVKWSQGS
    GADFPRLSVKVKPELVAFGAPEEVVVDRHGVVNGGQHLEPEEVNSLVDELGDDVVFFDGRNAFEAHIGRFEGAVVPDTQT
    THDFVRELESGKYDHLKDKHIVSY
    CTGGVRCEILSVLMKNRGFENVYQIKGGIVRYGEKFGTTGLWKGPLYVFDKRMVHH
    FDGETLTLGRCCVCEAPTERFLNCADPGCKRLRLYCDEHVAVAQSTVCTDCSERTQDVTYLKSH

    >gi|256831871|ref|YP_003160598.1| Rhodanese domain protein [Jonesia denitrificans DSM 20603]
    MTTPHHHTQRAHVWTTVSDLHTRLNSPHPPRILDVRWQLGRNDGRERYEAGHIPGALYADLDTQLAAPASPEAGRHPLPS
    LQALTESIRAWGITPDIPVVVYDTVGGMSAARAWWLLRWAGLTDVTILDGGLDAWTKQGHSLTQGFDTVDPTTITLTGGH
    MPTITTDDAEHFPEHGILLDARAPHRYSGEEEPIDPRAGHIPGALNTPTAHFIDEAGHLKPAADLTDILTDAGVIDPSHA
    DLDTDGLIASADQPLAVY
    CGSGVTAAHAIAVLASLGIEAALYPGSWSQWSHDPHRPVATGNHTEP

    >gi|256831954|ref|YP_003160681.1| glutaredoxin-like protein [Jonesia denitrificans DSM 20603]
    MSASPFPASPGSVVMYSTSWCGYCRRLTTQLNSANIPYTEINIEETPGTADYVESVNGGNQTVPTLVFADGTAMTNPSLA
    QVKDKLEQLSS

    >gi|256831969|ref|YP_003160696.1| redox-active disulfide protein 2 [Jonesia denitrificans DSM 20603]
    MSTHITVFGPGCANCVRLDKEVHKALAATGINGTVTNVTDYADIAAAGVTATPGLMINGELLVTGRVPKAQEIGELLTRY
    SG

    >gi|256832129|ref|YP_003160856.1| thioredoxin [Jonesia denitrificans DSM 20603]
    MATHDITKEQFADTVANNDIVLVDFWAEWCGPCKQFGPIFEQSSEQHSDIYYAKVDTEAEQELAAALQITSIPTLMAFRE
    GILVFAQPGALPAQSLQQVVDGVKGLDMDDVRKQLAQAQAEEAAQQ

    >gi|256832134|ref|YP_003160861.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Jonesia denitrificans DSM 20603]
    MSVRLEPGTPAPAFTAPTATGEEFSLADAAGKKVILYFYPAAGTPGCTTQACDFRDSLASLQGAGYTVIGVSPDSADKLA
    SFADKEHLTFPLVADPDKTIATAYGAYGEKNNYGRTVMGIIRSTFVLDEDHTITHALYNVKATGHVARLRRDLGLDG

    >gi|256832145|ref|YP_003160872.1| Heavy metal transport/detoxification protein [Jonesia denitrificans DSM 20603]
    MANATDITHTLLRAEGFSCPSCVTKIEKQVGKLDGVENVTVHFASGRVEIDHDETRSSVDDLIAAVDKAGYKSKASAF

    >gi|256832176|ref|YP_003160903.1| hypothetical protein Jden_0944 [Jonesia denitrificans DSM 20603]
    MSEVQTAAADMWFDPMCPWAWMTSRWLTEVEKVRPVRVRWHVMSLSVLNEGRDLPADYRALMDDGWGAVRVVTAAGQEVG
    DHVVKPLYDAMGTRFHPGGRTDRRVVVQESLAEVGLDPDLMDAYDSTAWDESLRASHRRGIDQVGEDVGTPIVAVNGVAF
    FGPVVTPAPRGEDAGRLWDGCILVAGTPGFFELKRTRTQGPQF

    >gi|256832382|ref|YP_003161109.1| OsmC family protein [Jonesia denitrificans DSM 20603]
    MNVLYTTEALATGGGRDGHVAVAGTDLAFDLAVPTSMGGSGNGANPEQLFAAGFAACFHSALQLVARQRKVSVDGSSVAG
    RVSIGATDGGGFGLAVELEVSLPGVDKEVAQEIAEEAHQV
    CPYSNATRGNIDVTVTVGNN

    >gi|256832452|ref|YP_003161179.1| glutamate synthase, NADH/NADPH, small subunit [Jonesia denitrificans DSM 20603]
    MADPRGFLKVRERELPGYRPVSVRLMDYADVMVKRDPTSPYLARQASRCMDCGIPFCHQGCPLGNLIPDWNDLVRRGLWR
    EASDRLHATNNFPEFTGRVCPAPCEDSCVLGISQPAVTIKNIEVSIVDEAFRQGFLPPVVPERLSGKTVAVIGSGPAGLA
    AAQQLTRSGHTVVVFERDEAVGGLLRFGIPDFKLEKHHIDRRIEQMVAEGTRFRVSTQVGVDVSWAEVYETFDAVVVATG
    APVPRDLPLPGRDLGGIHFAMDYLVRSNRQ
    CRGSEVSDPIDARGKHVIVIGGGDTGSDCIGTALRQGAASVTNLAIGVEP
    PKVRPESEPWPVTPRLFEVSSSHEEGGSREFLASTVEFVGSHGQVEALRVATTEYLSDGRRVPTAGTERDLPADLVLIAL
    GFTGAETDTFVDSAALSCDKRGRIARTDEYESSMPGVFVAGDAGRGQSLIVWAIAEGRAAAASVDEYLQGGTELPRPVKA
    STMALRP

    >gi|256832478|ref|YP_003161205.1| UBA/THIF-type NAD/FAD binding protein [Jonesia denitrificans DSM 20603]
    MTPDFTTAETIHYARQMALPGFGHTAQQALRDAHVLVIGAGGLGSPALMHLAAAGVGTLEIYDDDTVDPSNLHRQLIHSY
    PRIGQRKTDSAATTLTQLNPHITIITHPTRLTHNNAYDAINRADLVIDGTDNFATRYLINDICVTTATPYIWAAISAWDA
    HISVFALPHTPCYRCLHPTPPPPNTVPT
    CAQTGVLPTLPGLIGTTQAHEAITLITGIGTPLTGTLATYSGHTNTWNYLPL
    NPSPTCPTCSTKPTTTPHHQPDPPPPTRPTNHPSALTNHPSALTNHPSALTTATTIDIRPPHTTHTNPWPTTLTIPLPDI
    LANPHATATRLATHPAPRIIYCESGTTAQLAALTLTDAGLTDVSAHPGPPQ

    >gi|256832682|ref|YP_003161409.1| iron-sulfur cluster assembly accessory protein [Jonesia denitrificans DSM 20603]
    MSEATDIATHGVNLTDVAASKVRTLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERLLDGDALRDYDGVEVVVDKMSVP
    YLDGATIDFADTIEQQGFTIDNPNAGEGCACGGSFA

    >gi|256832700|ref|YP_003161427.1| dihydrolipoamide dehydrogenase [Jonesia denitrificans DSM 20603]
    MAETAGTDFDIVVLGGGSGGYAAALRAAQLGQNVALIEADKLGGTCLHYGCVPTKALLHAAEVAESVREGHQFGVNATFN
    SIDMDGVNSYKANVINGLYKGLQGLIKSRKITVVEGYGKLVGPNSVEVNGQRYNGKHVILATGSYSRTLPGLAIEGRVMT
    SDQALTLDYVPKSAIILGGGVIGCEFASVWRSFGADVTIIEGLPHLVPNEDESISKALERAFRKRKINFNLGDLFSSVTQ
    DDNGVHVTLQSGKTFDAEIMLVAIGRGPRTADLGYEEQGIRMDRGFVLTDDRLHTGVANIWAVGDIVPGLQLAHRGFAQG
    IYVAEQILGLNPAPIVESGIPRVTYSEPEIASVGLTEKKAQEEFGADNVETLDYNLAGNGKSKILATQGFIKLVRQKDGP
    VVGVHMIGSRVGELVGEGQLIVNWEAYPEDVASLIHAHPTQNEALGEAFLALAGKPLHAHN

    >gi|256832734|ref|YP_003161461.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Jonesia denitrificans DSM 20603]
    MIGVGARPAQRVLRDTHGTPFAVGGVMPRPMCLVFLPFAFSPVCHREVGGLSDRFPAFSDAGVDLVFVTCDPLFSLKAWA
    EQNRFSGVFLSDFWPHGDLSRAFGVFDETDGFAHRGSFLLDGTGVVRWSTRVGRGESRDLDTHLDALDVVRPGSATFLP

    >gi|256832829|ref|YP_003161556.1| Rhodanese domain protein [Jonesia denitrificans DSM 20603]
    MRSHLARTTTTARTTQATTRMTALAALATASMIALTGCSSSSTPQSSNTTTPSIEITDTTVILDVRTEQEWNEGHLDGAE
    LLDFTGGDFTQALPDLDPDADYVLY
    CRSGNRAGQAAALMDDAGFDSVINAGSVTEAATATGLDIVVP

    >gi|256832830|ref|YP_003161557.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Jonesia denitrificans DSM 20603]
    MKLVVVGGVAAGASIAARARRLDETAEIIVLERGHHISFANCGLPYHIGDVITDRQRLLVQTPQSLRESLNIDARTGHEV
    IAIDREARTVTVRNIDDNTEYTETYDALALTPGSEPVRPPLPGIDSPNVMVLRRIGDMDRIKQRIDDALEAHANKERGPV
    TAAVIGAGYIGLEMAENFHHRGVTVNVVEAADQILPPVDREIAVPVENHLRARGIGLHLNTAAAAFVDQEGGRVRVELTN
    NSSLEADIVILSVGVRPSSALAQAAGLELSPKGGVIVDEHMRTSDPHIWAAGDVVETPHTVLPGQSLFPLAGPANRQGRV
    AAENICGRSTTYTSTQGTSIVKVFDMVAGGTGATERQLVDAGVAYRAVHVHPSGHAGYYPGTAAMHLKVLFDPESGKLLG
    AQASGFDGVDKRLDVLATALRLGATVYDLEELELAYAPPFGSAKDPVNMAGFVGANTIRGDLTLWYAQDFPQAVAGAKVV
    DVRTPEEFDLWHIPGAVNVPLATLRDEVEQWDPTIPVRLY
    CAVGFRSYLAHRILVQRGFADVRTLSGGSITFRAWHEVEG
    EGASPQHAEISHAPAGGDPALEKIAAAVAQGPAHHIDLDCTGLACPGPIMSLKKTAASLKPGDEVTVTVSDPGFAHDGPA
    WAGANGHEILDLTPHGPGYRMTMRMGGAVAPASGAGVVTDPREGMSFVVFSGDLDKVLAAFIIANGALAMDKPVRMFFTF
    WGLNALRRENPPARDRKALDKMFGAMMPSGPDALKLSTMNMAGAGTAMIKKVMKDHSVSSLPELMSAAIEGGAEITACTM
    TMDLLGIAESDLIDGVQLGGVATFIAAAEKSGSTLFI

    >gi|256832952|ref|YP_003161679.1| putative thioredoxin domain-containing protein [Jonesia denitrificans DSM 20603]
    MTESAHPDIHVRGAVDLSALQAANQKVPADRPAPAAGGYVVDLTEESFSAVVQRSTEVPVLIYLWVNDDQGCVTMADTLG
    NVVESAQGRLLLGRVDVQAWPRIAAAFQVQDVPAVVGLIGGQPVPLFAGVQDAQTIASVLDQFLQAAAANGVTGVIEPQG
    DTGQEPAHDAQAEPEPLPPLHQEAFDAIERNDFDTAIAAYTKALKQDPKDTMAAAGLAQVSLLQRTASVDLGEVRSHAAN
    APDDVDAQLAVADVDMIGGKVEDALDRLISLIPSLTAEDRERVRVRVVDYFEILGADDLRVAPARRRLASALF

    >gi|256832972|ref|YP_003161699.1| glutaredoxin-like protein NrdH [Jonesia denitrificans DSM 20603]
    MSVTVYSKPSCVQCDATYRALDKKGVEYTVIDLTQDPEAMDMVRQLGYMQAPVVMAGDEHWAGFRPDRIAALAARVSVTA


    >gi|256833115|ref|YP_003161842.1| peptide methionine sulfoxide reductase [Jonesia denitrificans DSM 20603]
    MFQGLFGASLRSHMVSPERALAGRPERPFSLPARHRVFDTPLEGPFPDSSHVVYLGLGCFWGAEKELWQLPGVISTAVGY
    MGGYTPHPLYEEVCSGMTGHTEVVRVVYDPTVISDRDILVHFWESHDPTQGFRQGNDVGTQYRSAVYVTTTDQERLARET
    LMAFQRALEERGFGRITTQVAWAGSDHEDGVGDFYFAEDYHQQYLVKNPQGYCPVHSTGVACS

    >gi|256833358|ref|YP_003162085.1| glutaredoxin [Jonesia denitrificans DSM 20603]
    MTVILYTQPGCGPCVAQARALTKHGITFETVNIRETPEAAERIAALGATSTPVIEVTTPLGSWYWAGFSLDKTKHLQQLQ
    NGQ

    >gi|256833452|ref|YP_003162179.1| methionine-R-sulfoxide reductase [Jonesia denitrificans DSM 20603]
    MTYPVTKSDQQWRDELNDLEYAVLRHAATERPFTGDLLGETRTGTYHCKGCDSVLFDAATKFDAHCGWPSFFDPANNSAV
    VLKDDLTLGMTRTEVVCAACGSHLGHVFDDAPWTPTGQRY
    CMNSVSLTFRPDSGATGHVGADAHE

    >gi|256833496|ref|YP_003162223.1| glutaredoxin [Jonesia denitrificans DSM 20603]
    MTVILYTQPGCGPCVAQARALTKHGITFETVNIRETPEAAERIAALGATSTPVIEVTTPLGSWYWAGFSLDKTKHLQQLQ
    NGQ

    >gi|256833548|ref|YP_003162275.1| Heavy metal transport/detoxification protein [Jonesia denitrificans DSM 20603]
    MTASAPTLKTTTLRSDEFSCPSCIQKIETKLTGLDGVESAEVKFSSGRIIAQHDPQKVSVRDLVEAVAEVGYTAKPSAI

    >gi|256833654|ref|YP_003162381.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Jonesia denitrificans DSM 20603]
    MRQRPPAVFTGGVSTPHTSLPRVRASALTGRNWLNTGGRTLTLDELRGKIVILDFWTFCCINCLHVLDELRELEEQHRDE
    LVIIGVHSPKFVHEADPDALAAAVERYGVAHPVLDDPTLSTWQAYTARAWPTLVVIDPEGYIVAHMAGEGHAPALARIVT
    QLIEDHDARGTLHRGSGPYVPPPTTAGMLSFPAKAVPLPAGGYLVADAGHHQIVHVAADGVTEQARYGAGERGLVDGPAH
    TAQFNEPNGLLVLPPDVAAEVGYDVVVADTVNHCVRSLSLSTGAVGTLAGNGRQYMVGGPDNEGRLTSPWDVVWSAHRKQ
    VIIAMAGNHTLWTLDPRTGQCQWFAGTMNEGLVDGPVAQSWFAQPSGLAVTGVDADERVWVADSETSALRWIDTSDTVHT
    AVGAGLFDFGHRDGDADQALFQHPLAVAALPDNSLVVADTYNGALRRYDPATRTVSTLASGLAEPSGMVVHHEGGELSVV
    VVESAAHQLTGVALPASLVGEVLDTGAHRTQRPTTAVRGGQVDLRVVFTPAPGQKYDDRFGPSTRLSVSATPENLLLDGA
    GDTVELTRTVRINPDVEQGVLHVTAQAASCDDDPAIEFPACHLAQQDWGVPVTVSHDGADSLDLSLRG

    >gi|256833686|ref|YP_003162413.1| glutathione peroxidase [Jonesia denitrificans DSM 20603]
    MDLTALNNTAITMIDGTATTLGQWGGQVRLIVNVASRCGLSPQYAQLEELQEYYGPKGFTVLGCPSNQFLQELSSEEKIV
    DYCAENWGVTFPMTARLRVNGRSQHPLYELLTTIKDDNGKAGRVKWNFEKFLIAPTGESYRFRPTVQPTDRVITSVIERH
    LPQQ

    >gi|256833709|ref|YP_003162436.1| heavy metal translocating P-type ATPase [Jonesia denitrificans DSM 20603]
    MAHPQQLPTDTPTDRPVLAEVDLSVSGMTCASCVARVERRINKIPGATATVNLPLESAHVVLTEPVSNEDLIAAIERAGY
    TGAVTSRAQTQGIPASESTVTQPPDAGDEHTSHGAALDGGHAGHDGDADTSAPVPDRGADLAHRLRWSAVLTVPVLLLSM
    IPATQFTGWQWVVAALSLPVVTWGAWPFHRAAFRAARHGSSTMDTLVSTGVLAATAWSLWALFFGGAGELGMRMTMSLIP
    ARSHGSMAEIYFEVAAVVTTFLLAGRFAEHRSRRQAGDALRSLLELGAKDAHLVRRANGETVDLKVAVDDLIVGDVFAVR
    PGEKIATDGVVVRGQSAVDTSLLTGEPLPVDVREGDHVTGATINTSGYLDVEATRVGKDTTLAAMGRLVSQAQTGKAPIQ
    RLADRISAVFVPIVMVIAVLVFAGWLVWGPSLSAAFTAAVAVLIIACPCALGLATPTALLVGTGRGASLGILIKGPEILE
    STRRIDTVVLDKTGTLTAGRMTVDTVFGPDEVLIYAGAVEQGSEHPIAQAIVDSARTVHPTAPDPDGVDRNWEVTDFQAA
    AGGGVSGVVRLPHSGVDMGARVLVGRPAWLAEQGVSTDRVDLRQIVADAEADGATAIAVAWAGQWQGVITLRDQLKDTSA
    TAVREFRDLGLSPVLLTGDNRGAALAAAQEAGITEDNVYAQVLPADKVSVVRDLQAQGRTVAMVGDGVNDAAALAVADLG
    LAMGTGTDVAMQASDITLVRGDLRAAATAIRLSRDTLRIIKQNLFWAFAYNVAAIPLAAAGLLNPMIAGAAMAASSVIVV
    SNSLRLRRAG

    >gi|256833755|ref|YP_003162482.1| thioredoxin reductase [Jonesia denitrificans DSM 20603]
    MSDTATHDVIIIGSGPAGYTAAIYAARAGLSPLVLAGSITAGGALMNTTEVENFPGFPDAIMGPALMENMQKQAETFGAT
    IEWDDAETLELTSDIKTITTANGDTYRAKAIILATGSAYRELGLDDEKRLSGKGVSW
    CATCDGFFFRDQDIIVVGGGDSA
    MEEATFLTRFARSVTIVHRRDELRASKIMEERARNNEKIRFIFNSEVVAIHGDDKVSGVRLRDTVTQEETEHDATGVFIA
    IGHDPRSELINTQVDTDANGYVLVKGRSTLTNLPGVFACGDLVDHTYRQAITAAGSGCSAALDAQHYLESLND

    >gi|256833756|ref|YP_003162483.1| thioredoxin [Jonesia denitrificans DSM 20603]
    MSHTVAVTDATFDTAVLQSDIPVLVDFWAEWCGPCRQVAPILEELAEEYAGRITIAKLDTDANPATTMKYGIVSIPTLNI
    YKGGEVVATIVGGRPRRQLAQEIDAVLAQ