Ilyobacter polytropus DSM 2926 uid59769

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|310777826|ref|YP_003966159.1| electron transport complex, RnfABCDGE type, E subunit [Ilyobacter polytropus DSM 2926]
    MGKKEMKILTQGLIKENPVFVLLLGLCPTLGVTSSAINGLAMGLATMAVLVCSNSIISAVKKIIPDKVRIPAYIMVIASL
    VTIVEMVMKAYVPALYAVLGLFIPLIVVN
    CIVLGRAESFAAKNGVFLSFLDGVGTGLGFALALTLLGGIREILGNGSLFN
    ISFIPEGFSPALIFILAPGAFITIGCIIATQNYIKIRKSEKIQNSVEV

    >gi|310777827|ref|YP_003966160.1| electron transport complex, RnfABCDGE type, A subunit [Ilyobacter polytropus DSM 2926]
    MDLGNLFSIVVGAIFINNFIFAKFLGICPFMGVSKKVESSIGMGMAVAFVMTLASAVTWIVYKFLLVPYGLEYLQTIAFI
    LIIASLVQFVEMAIQKTSPHLYKALGVFLPLITTN
    CAVLGVAILNIQEGFNFIETVVNGFAGAIGFTLALVLLAGIRERL
    EYADVPRPFQGVPIAFISAGLLAMAFMGFSGMQI

    >gi|310778207|ref|YP_003966540.1| methionine-R-sulfoxide reductase [Ilyobacter polytropus DSM 2926]
    MNHLFTLLFLIFSTLAFSMDFSSFEKPTDSELKKTLTDLQYKVTQKKGTERPFDNEYWDNKKEGIYVDLISGEPLFSSKD
    KYKSGTGWPSFTKPLVDENVVTKKDFSLFMIRTEVRSKYGDSHLGHVFKDGPPPTNLRY
    CLNSASLRFIPKEKMEEEGYG
    EFLKEFEE

    >gi|310778261|ref|YP_003966594.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MEKIYDMIIIGGGPAGLTAAIYAGRAQLNVLVIEKRELGSLISAHKIDNYPGFPDGITGRELYQLKKEHALKYNVNIVEG
    TFLELDIFSEPKIVKTDVENYHGKSVIIASGWPKNSVKKIKGEQEFIGKGVSY
    CATCDGAFTRNLKVGLFGQGDEVAEEA
    LFLTRYSKEIFIFSKENSLKCNEELKNALLSHENVKIIPNSSIVEIKGNDYVEEVVVSRDGLEESYSLDYTFLYLGTRST
    EELFSGFAKLDPNGYIITGEDMKTEVDGVYAAGDIRSKAIRQVTTAVADGTIASLEAAKYILKQKKES

    >gi|310778355|ref|YP_003966688.1| peptide methionine sulfoxide reductase [Ilyobacter polytropus DSM 2926]
    MKKIILFFIISIFSFAAEKEAYFAGGCFWCMEPPFEKLAGVLSVTSGYSGGDIENPSYKEVASGKTKHREAVKIIYEDSV
    VTYPELLEIFWKQIDPTDPGGQFVDRGFQYSSAIFYTTEEQRSQALKSLENLENSKKFEKKIVTDIVKFKNFYPAEDYHQ
    DYYIKNKLRYKFYRYSSGRDQFLNSIWK

    >gi|310778452|ref|YP_003966785.1| peptide methionine sulfoxide reductase [Ilyobacter polytropus DSM 2926]
    MKTITLAGGCFWGIEAYFKRVRGVVHTSVGYSNGTKENPDYKEVCSGKTGHAEVCKIDYDDSILPLDKILDHFFRLIDPT
    VLNRQGNDTGTQYRTGVYYSSDDDLPEIKEFVKSIAKKYSSEIVTEIEPLHNFFPAEDYHQEYLEKNPSGYCHINFSLLK
    DEEKQDPV

    >gi|310778585|ref|YP_003966918.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MKIVIIGSVAAGTSVAAKARRNNEECEITIYEKDSDISYSGCGLPYYIGDSEIERDVLTPRTDKWFEKRFNMDLKIGHEV
    LSINKDNKTLVVKNLNTGEEFEDNYDKLVIATGASPIKPPIAGIDGKNVFFLRNVKSADNIIEYIASNSPKKAVIIGAGY
    IGLELLENLENLGIEVTVVEREDRAMSKMDKDMAVYLEDYLTKKGVNLILGEEVTKINEKSVETATGKKIDADFAVVCTG
    VRPNSKLASGIGVEVYPNGAVKVNHKLETNIDDVYAVGDVAMAWSIINGEPMYVPLGSTANKMGRICGDVITGGHLRFKG
    ILGTGIFKVFDMAVASTGMTEEQALERGYDVEVIHNIKPNQTAYFETSREMVIKAVADRKSGKLLGVQILGENGVDKRMD
    VFVALMSTGATVDEFFHLDLAYAPPFSTTKDPVMYTGMILENAIYGKNKILSVKELMENRECYTVIDVRASKQYDAAHIP
    GAINIPLGDLRSEALKLDKNKKYVVH
    CNKGVTGNAAQNVMLNLGFDCYNLSGGYKNYSVQTKN

    >gi|310778865|ref|YP_003967198.1| glutaredoxin [Ilyobacter polytropus DSM 2926]
    MIKVYGKAGCSRCEELKGLLEGKKTEFQYIEDTNELRRVAIKAKIMMAPIVEYDGGLYTMEEFLKKSGL

    >gi|310779004|ref|YP_003967337.1| ADP-ribosylation/Crystallin J1 [Ilyobacter polytropus DSM 2926]
    MSKKGLLLGSVLADAFSLGGHWIYDTEKIKNEFGEYNDLNDPLPDSFHKNRKKGEHTHYGDQTLLLLEYLAEKNEFDKNS
    FRDFWEFHMKKYDGYMDHATKKTLEMIETGEEWGSDSNDLAGASRIAPIIYCFSQDKGVEYSKVQTKITHDNEQVIAASE
    FFARTAYRVLEGIKPDKAMEEVSAQMENKWISEKLAIAKSLIETETVEAVKKLGQS
    CSIEGAFPATILLILKYSDNYEEA
    MIKNVMSGGDSAARGLIAGMIIGAYSEATIPKRWLKEMGSLERVNF

    >gi|310779006|ref|YP_003967339.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Ilyobacter polytropus DSM 2926]
    MERTGIITMKGNPLTLLGNEIKAGDKAPDFTALKNDMSPFSLSDLKGKVVIISAMPSVDTPVCELQTTIFNQKAGENPEI
    SVVTISVDLPFALNRFCANEGIESAVTLSDHRDLDFGSKYGFNIKELRLLARGVVVIDKEGTIKHLEVVSEVTDQPDYDK
    ALEVAQSLI

    >gi|310779149|ref|YP_003967482.1| heavy metal translocating P-type ATPase [Ilyobacter polytropus DSM 2926]
    MIYIKKEYLIKNLHCGGCAAKIEEAVSSLKGTKEVHLNFMKKKITLKISGEDDKSFLEKINKLADSIEPGTYFEDINDKS
    KDLKIKLSGLN
    CAGCAVKIEDKVSKLDFVDTVSLNFSKQILDLNISEKNMESEIFKKVEKIVKSLEPHVNVTYEHSEIVY
    HDHGHDHFHGSMARKELLFLFIGGALFIAGLFMENIPNLKIFLMVIAYILVGGDIVINSFKNIKRGNFMDENFLMTIATF
    GAFSIGETSEAVGVMLFYKVGEYFQDRAVENSRKSIESLMDIRPDYANLKNNNGKFEKVSPDKVNIGDIILVKPGEKVPL
    DGEISKGNSTVDVSALTGESLPKDVSLGDEILSGSVNKNGTLEIKVSKDFSHSTVSKILEMVENASSKKAPSEKFITKFA
    KFYTPIVVFSALAIAFIPPIFVGEFSSWFYRALIFLVVSCPCALVVSIPLSFFSGIGSASKKGILVKGGNYLEELNNVKA
    VVFDKTGTLTMGKFKVTDIMAVNGDKEELLELAAAAEWYSNHPIGECVKNSLEKPINEENIENHHELEGYGIKAHYKKDE
    ILTGNAKLLKKHSIKFDEADLLGTIVYVAKNGVYAGYILISDEIKKDSHEAVKRLKEIGIKSFMLTGDRKKVAEKIGKEI
    GIKEIHSELLPDEKVDHFQKIKEQIKGSVIFVGDGINDAPVLALSDIGVAMGGIGSDSAIEAADVIIMNDEPIKLREVID
    VAKFTRVIVLQNISLAIGIKLLVMALGIGGMATMWEAIFADVGVALLAVLNSMRILKHK

    >gi|310779291|ref|YP_003967624.1| copper-translocating P-type ATPase [Ilyobacter polytropus DSM 2926]
    MNKKFKIDGISCQACVARIEKAVGKIKGVDSTTVNPISEILTVEADEKKVSSEDIKKIVSDLGYGIKERETKLNKATLKI
    DGMT
    CQACVKRVEKAVNKLEGVLDGNVNLTTEKLSVSYDENSVGLDEIKKAVVDAGYSIEEEKKINTVTLSIDGMTCQSC
    VSRIEKKTSQLLGVETINVNLATEKALVEYRKNEIKLSEIVKFINELGYKAVKEDTVKDLDGDKKQKELQNEWKKFIIAI
    LFALPVFYISMGHMMGMPVPRIINPENNPMNFALIQLLFSIPVILIGKRFYVTGIKLLFKFSPNMDSLIAMGTGAAMIYS
    LYGTYMISSGNIEYVHFLYYESAVVILALIMLGKYLENVSKGRTSEAIKKLMGLQPKKASLIKNGDIVEVDIEDVEKGDI
    LLVKPGESIPVDGEVTEGSSSVDESMLTGESIPMEKTPGSKVVGASINKNGSIKIRATAVGSDTALAKIVKLVEDAQGSK
    APIARMADVISGYFVPVVIGIAIVSAITWYILGTTGKVVLSETPAIFSLSIFIAVLVIACPCSLGLATPTAIMVGTGKGA
    EYGILIKGGEALEMTHRVDTIVFDKTGTITEGKPKLTDVISSGELSDNEILKLAASAELHSEHPLGDAIVEGAKEKGLKF
    AKIEKFNSITGMGIEALVDEKNILVGNQKLMKTKGIEVNFTPEEDQLSKEGKTLMLVAADGKFQGVVAVADTVKKTSKEA
    VKILKEMGIKVAMITGDNALTAEAIAKEVGIEIVLSEVMPEDKSIEVKRLQKNGARVAMVGDGINDAPALAQSDVGIAVG
    SGTDVAIESADIVLMKSDIKDVASAIQLSHATIRNIKQNLFWAFAYNSMGIPVAAGVLYLITGHLLNPMIAGAAMAMSSV
    SVVTNALRLRFFKPKF

    >gi|310779387|ref|YP_003967720.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MGKKYLVVGGVAGGASAAARLRRLNEESQIIIFEKGPNVSFSNCCLPYHLSGTVKQAESLILMSPQKFASQYNIEARVNN
    EVLKIDRANKEVEVLDITSGKTYRESYDKLILSPGAKPIVPSIPGIEKVNTFTIRNVVDIKKLNLFINDVNPTRITVIGG
    GFIGVECAENLVEAGYNVSLVEAMPQILKQFDYDMVQILNKEIVDHGIDLIVGDRVSSFDENKVILESGKKLDSEVVVLA
    IGVNPETDLAVNSGLEIGKTGAMKVDPNFMTIDPDIYAVGDAIEVYNPLMQDYFKLPLAGPAQKQARSVADHIHSRCINN
    TGYIGSSVIKVFNYGAAATGLNEHLLKDMKIEYDSVKIIPKDKVGLMPDSEEVHFKLLFEKPTGKILGAQAIGRGNVDKR
    IDVIATAIKFGATIENLRDLELCYAPPFGTAKDVVNFAGYVASNLLHGSFRQVPAQKVRELVETKKYIIDVREKKEYDTS
    HIKSVKNIPLSELRKRVDEIPKDQPVYLH
    CRSGQRSYNAVLALQNLGFNNVFNISGGFMGISFYEYFNDKTTGREPIVTD
    YNFL

    >gi|310779428|ref|YP_003967761.1| NADH:flavin oxidoreductase/NADH oxidase [Ilyobacter polytropus DSM 2926]
    MERKYPNLCKPIKLGNVYFRNRMFGAPMGGTDITADCTVGPASTAFYENRAKGGAANVTVSELVVHPETEGSHMYHLDLQ
    TVDSLSSFTYTADAIRRHGAIASVELSHSGQYAGTYLVDKEKKQGMGQWGPSAGTRPDGREVHELTKELIDDIVKSYGEK
    AALAKKAGFEMIMVHAGHGWLINQFLSSHFNKRTDIYGGSLENRVRFLQEVLDSVRNAVGYGFPIELRMSGSELFEGGYT
    LEDGIEIAKLVESKIDLLHVSAGTYQRGFGITHPSMFIPHGANVYLAAEIKKHVSVPVATIGGLNDPEMMEEIIASGKAD
    VVEMARALLADPELPKKVMLNKDEHIIHCLRCYTCMAERAETGTRRCTVNPIIGRESDGLEINPAPVKKKVLVVGAGPGG
    LKAAITAAKRGHEVVL
    CEQNSEVGGILIGEQAIPFKHEMYQLGVTLGKLAEDAGVDIRLNTRVDKAYADKENADAIIIAV
    GSEPFLPPIEGLTRDTAILINDYHEKVDRVTDEVIVLGGGLAGCEAAIHFAREGKKVSLVEMNEEFSPDANIRHRPLLLA
    EIDKSDIAIFKSHKAIKVSENGVLCVNKEGKEVFVSGTTVVCALGQKSRRASVDELWDSALMVSQIGDCVKVSTITTAIY
    QGHHAALDI

    >gi|310779461|ref|YP_003967794.1| methylated-DNA/protein-cysteinemethyltransferase [Ilyobacter polytropus DSM 2926]
    MVGRVYLEHPVLGIIEICEETDGISSVEFVNGKKSEIKSPLVLKCKKELEEYFYGDRIKFSVTLDVHGTDFQVKCWKELS
    KIPYGKSISYKVQAENIGNPKAVRAVGGANSKNPISIIIP
    CHRVIGKNGKLTGYASGLWRKEYLLKREGEIKGR

    >gi|310779479|ref|YP_003967812.1| thioredoxin [Ilyobacter polytropus DSM 2926]
    MGKAIELNEAAFKKEALEGKGVVLVDFWAPWCGPCEMMEPFFDELSDEVHAKICKVNVDEYPAIASEYGIRSIPAMLVFK
    DGHKIDQLTGFMHKDDLREKLEAY

    >gi|310779480|ref|YP_003967813.1| thioredoxin [Ilyobacter polytropus DSM 2926]
    MSKVIQLDEATFKTEVLEGKGVVLVDFWASWCGPCKMLGPILEELSEEVTANICKVNVDEYSGLAAEYGIRSIPTMIVFK
    DGKKVDQLVGLMQKPALKEKLESY

    >gi|310779676|ref|YP_003968009.1| dihydrolipoamide dehydrogenase [Ilyobacter polytropus DSM 2926]
    MDYDIIVLGGGPGGYVAAIKAAQMNAKTAIIEMGNFGGVCLNWGCIPTKTLLKSAKVYQYILNSSKYGIDIDDLSNVNIN
    WEKMLQRKKDVVKKLTSGVEFLLKNNKVDIYRGFGNVIDKNSIEVNGNRLSCKNIILSTGSSPNIPEIPGVKDGLKSGFV
    ITSKEALELLKIPEKLVILGGGVIGVEFATLYSSLGTKVTIIQNMDRILEFMDHDVINEMEDILLGLGVEILYNTSIVKV
    NKTDLTIKDKDGERDIDADNLLISIGRYANMKGLEKLNLETYRRGVKTNEKLETNIPGVYAIGDLNGVFNLAHVASAEGI
    IAVENIMGEDKKIDYRKAPNCIYSFPEMAAVGYNEVDARNKFKDIIVSKLPLSANGKALAEGESTGFIKIIADKEYGEII
    GVHIIAPTATDMVSEIVTTMELEGTIYDVARVIHPHPTISELVMEAAHGAVHKNKDT

    >gi|310779790|ref|YP_003968122.1| RnfA-Nqr electron transport subunit [Ilyobacter polytropus DSM 2926]
    MIPDIHPFTLFLASIFTSNILLANFLGMCSFISISKDMTSSNGLGMAVTGVLTLTSMINWVVLKYILIPLDLLYLRFIVF
    IVVIAATVQILEMLIDRLSPSLYIALGIFLPLITVN
    CAILGVTLFIEIRNYSFIQTASYAFGSGLGWWLAIMALSAIQKK
    IKNSPVPAGLEGPGITLVTIGFMAMAFIGFSGMLIVQ

    >gi|310779791|ref|YP_003968123.1| NADH:ubiquinone oxidoreductase, subunit D [Ilyobacter polytropus DSM 2926]
    MNTAKNLAKENIWNNNPVFVQILGICSTLAVTNNLTNTFIMTVSVTFVTAFSNLSVSILKNYIPRKVRMIMQTLIIAFFV
    IIVDIMLRAYLPDISKSLGPYVGLIITN
    CIIMGRAEAFAQSNSPLISFWDGITSGIGYMWVLMIIAFFRELLGFGTLFGI
    KILSSEFTPWTIMVMAPSAFFILGILIWIVKTNMMRQDEKNEIPAKQTN

    >gi|310780080|ref|YP_003968412.1| selenide, water dikinase [Ilyobacter polytropus DSM 2926]
    MKFPSNECSVGGCACKMGPAVLSDLLSTLPTLEDKNLIVGYEKSDDASVYKLTDDLAMIQTLDFFAPMINDPYIFGQVAA
    ANALSDVYAMGGEPKTAMNIVCFPEKMDISYLGEILRGGAEKVAEAGAVLSGGHTIHDEKIKYGLSVTGIIHPDKILKNY
    GAEEGDTLILTKPLGAGIIATAYSVGEASDEAVEKLLENMTTLNKYSMDIIREYPINACTDVTGFGFLGHAFEMAGGSEK
    SFILEKELIPYMEEAKAYAKEFYITSGGQKNRNHLGNRVVFNDVPFWLQEILFDPQTSGGLLFSVKSEYSEEIMDRLSKL
    KIKSSIVGRVTAKQKHTIIVE

    >gi|310780177|ref|YP_003968509.1| alkyl hydroperoxide reductase F subunit [Ilyobacter polytropus DSM 2926]
    MEKIYDLIILGGGPAGLSSGLYAGRARLDTVIIEKGIAGGQAATTSDIDNYPGVKNAKGPEISDVMRNQAEDFGTEFITG
    DILEVDFSQEIKKVKTSSGEYRGRAVIISTGARPKKLGFPGEEKYTGRGVAY
    CATCDGEFFTDLEVFVIGAGYAAAEEAI
    YLTRFAKKVTVIAREPEFTCAKAIAERVLENNKIEVIFNTEIIEASGDEMVNYAKFRNNVTKETWEYKSGENFGIFVFIG
    YEPITEKFNGHVKMDDKGYIPTDETMKTDIEGVYAAGDLRPKMLRQVVTAVADGAIAATAAERYVSELKRKSGESQDEKS
    KPKAQVEKEAVKNKKLGFLKGEIAYQLREVFEKMEKEVIFVTIVDESVKKSLELKEVLEEIVQLGDKLELEVYKKGENPE
    IEEKINADKYPVVALLDSEGRYRGVKFHGIPGGHELNSFVMAVYNLAGPGQVISVDILEKIKEIDQKVNIKVGVSLT
    CHH
    CPDAVIAAQRLAIENENIEAEMIDVLQFADIRSKYNIMSVPAIIINDSEVTFGAKKIDEILQMLKK

    >gi|310780178|ref|YP_003968510.1| peroxiredoxin [Ilyobacter polytropus DSM 2926]
    MSLIGKKIEDFKVQAFHDGKFKEISDQVLKGQWSVFFFYPADFTFVCPTELGDLADNYEKFRELGAELYSVSTDTHFVHK
    AWHDASDTIKKIKFPMLSDPTGALSRQFGVMIEDAGLALRGTFIVNPEREIKAYEVHDLGIGRDADELLRKVQAAQFVAA
    HGDQVCPAKWKPGEETLKPNLDLIGKL

    >gi|310780194|ref|YP_003968526.1| Thioredoxin domain protein [Ilyobacter polytropus DSM 2926]
    MDLQQLKYKKFSFVYISREECSVCHALLPKIKKLSEKYNQATFQKIDLNECPEAAGEFMVFSIPALIIYSRGKELYRGAR
    FFNLSELEIKLDRYYDSIFN

    >gi|310780240|ref|YP_003968572.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MDKIYDVIIIGGGPAGLSAALYTSRSKLSTLILEKDKMGGQIVTTEEVANYPGSLFKTDEMETSGPKLVARMVKQAEHFG
    AEKIMKGVESLDFSGQIKKVITEDNTEFLGKTVIIATGAYSRKLGAPGEKALTGKGVSY
    CATCDADFFEDLEVFCIGAGY
    AAAEEAIYLTKFAKKVTIIAREPEFTCAKSIADQVMANPKIEVKFSSEVLEMRGDGILEEVTFRDNLTGETWDYVAEEDI
    GTFGIFVFIGYKPATDLFKGHINMDQWGYIPTDEFMATNIPGVYAAGDLRPKELRQVITAASDGAIAATAIEKYLTNFEI


    >gi|310780241|ref|YP_003968573.1| Thioredoxin domain protein [Ilyobacter polytropus DSM 2926]
    MIQLEKDTFEEKVLENKGLVLVDFWSDKCEDCKALLPHVEELSEEFGDKIKFTKFNTIGAMKVAIKQKVLGLPTVAIYKD
    GEKIYELVKENATKENIKKMINEVL

    >gi|310780242|ref|YP_003968574.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ilyobacter polytropus DSM 2926]
    MKTLKEALEKRNSDKKKALPSETLEYMDKVTNDLKEAGYENNPLNVGDKIPDGQLLNHRGETVSISELLGNKPAIISFYR
    GTW
    CPYCNMELAFYDELLGEISEEKIAMFAVSPEKPDVTMESIEIEKLNFKVLSDIDNKFARKLNLLFKVPEKLQTIYDG
    FGIDLKRSQGNEEAELPIAATYIIDKNGVITNAWVDADYTKRAEPSEVIEAYKKML

    >gi|310780245|ref|YP_003968577.1| DSBA oxidoreductase [Ilyobacter polytropus DSM 2926]
    MKIEIWSDFVCPYCYLGEKKLEKALETFEDKENIEITFKSFQLNQNEVKHKQGNYYNFISNKYGIPYELAKERMDAIKNE
    ASKVGLNYRYDIMIRNNTSLAHQAAKFAKDEGKEKIFVDRIFKGYFEEGADLGDLKNILFLAGEVGLNINKLENVLKEKS
    FLSEVTEDQEDASKLGINGVPFFIINDKIAVSGAQSIEHFKGALKKAAEM

    >gi|310780249|ref|YP_003968581.1| thioredoxin reductase [Ilyobacter polytropus DSM 2926]
    MNKEITIYSKNNCPYCVRAKMLLDSKKVNYTEINVEDHPEQREIMIKRSNGRKTFPQVLIGEFHVGGCDDLYALNDSKRL
    DPLLNLSETNSEAEHHNLAIVGSGPAGYTAAIYSARANLSPVLFTGREKGGQLTTTTDIENFPGFPNGINGVELMNSMEK
    QAENFGTKIIFGELTKVNLSQRPFTIYSGEKISTCDSLIIASGATAKYLNVPGESDYKGKGVSA
    CATCDGFFYKDEEVAV
    VGGGDTAMEEASYLTKLCKKVYLIHRRDKFRASQAMQDRVKNNPKIEIIYNSSVQEISGDGKEMNTLKVKNNLDSSVRSL
    DVKGLFISIGHTPNTNFLEGQLPLDEKGYLKVNHNGASTEIPGVFACGDVIDSNYRQAITASGSGCKAAIDAERWLEENK
    L

    >gi|310780339|ref|YP_003968671.1| FAD dependent oxidoreductase [Ilyobacter polytropus DSM 2926]
    MQRIGVFVCWCGSNIAATVDVEKVSEEIKNMPGVVYSSNYQYMCSEIGQNMLKDAVKEHNLDRLVISSCSPRMHEVTFRK
    AAKAAGINPYLIEVANIREQCSWVHKDKAAGTEKAIALTRAAVAKVALNQELVPGEIGVTKKALVIGGGIAGIQTALDIA
    EAGYKVDILEQSPSIGGKMAQIDKTFPTLDCSA
    CILTPKMVDAAQHPNITLHTYSEVKNVEGYVGNFQVDIRKKARYVDM
    DKCTGCGVCTEKCPSKKAKNEFEEGLSKRGAIYTPFAQAVPNVPVIDEKECIKLKTGKCGLCEKLCSAGAIKFDDKEEVI
    TENYGAIVVATGYDLINLDKFGEYQYSDHPDVVTSLEFERITNAAGPTSGKFVRPSDGNRPKKMVFVQCVGSRDKTERGK
    SYCSKICCMYTAKHAMLIKEKYPDIEAYVFYIDVRTPGKNFDEFYRRAVEDYGVNYIKGMVGKVFPEGDKLMVHGVDTMS
    GETLVIDADMVVLAAATKAKDDAVDLKRKLNISTDSDNFFTEAHAKLKPVETASAGIYLAGACQGPKDIPETVAQASAAA
    AKAIGLLNKAKLVNNPCVSKVDKDLCSGCLACTKMCPYDAISSEEIEINDHGKITKKVVAKVNEALCQGCGGCTVTCRPG
    AIDLKGFTNKQILAEVDAICQ

    >gi|310780346|ref|YP_003968678.1| Rhodanese domain protein [Ilyobacter polytropus DSM 2926]
    MKKLVVFLMGLFIVSVAMAKDYSQYANPEALVSPEKAKKIMESNKNVVVFDVRRSAEFMVGHIPGAVDIWRNDISADKNE
    YPFGGMRATVEKMENVLGQYGVDSNTHILIYDAKADYDAARLWWILDMYGHEKISLIDGGIDGWKAAGLSLEVGFAKKKD
    KKVYNFNKKTDYSKLAYLNDVKQAVENKKTIIVDTRSEKEHLGRVTKKGAFRPGRIPSKTFIPWETAVHNDSDKTFKSIS
    QLKEIYAEHGIDSNSQVIAY
    CQSGVRSAHTTFVLTQLLGYKKVRNFDGSWIEWSYNKKLPADKG

    >gi|310780406|ref|YP_003968738.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MRIIIIGSVAAGTSVAAKARRNSEECEIVIYERDRDISYSACGLPYYIGQKGIERSDLTPRDACWFKKRFNMDVRTGYEV
    LTIDPSKKSIEVKDHHTGEIFEDFYDKLVIATGAKPINPDITGVDNNNVFTVRNIESADKIIGYIAKTFPKKAVIIGGGY
    IGLELLENLVKLGIDVVLIEREKSLAGKLDRDISIYLEEYLKDKKVKFLLGEEVSEITEKKVITKSGKSIEADFVVSCTG
    VRPNSKLAKEIGIETFDNGAIKINHKLETSMEDIYAVGDVAMSWSIIDGAPMYVPLGSTANKMGRICGDVLTGGALRFKG
    ILGTGIFQVFDMAVAQTGMTEAQAKNKGYDIEVIHNLKPNQTEYFEESREMVIKAIADRKSAKILGVQIVGARGVDKRID
    VFVSLISMGATVDQLFHLDLAYAPPFSTTKDPVMYTGMILSNAINGKNKIITPEELIKERDDYIVIDVRSPKQYGIGHIP
    GAVNIPLEKLRNKAKALPNSEKYVVH
    CNKGVSGNAAQNIMLNMGFDCYNLSGGYKNFKIYTQLSK

    >gi|310780408|ref|YP_003968740.1| redox-active disulfide protein 2 [Ilyobacter polytropus DSM 2926]
    MDIKILGTGCKKCNTLTNNVKEAISETTVEASIEKVEDMKDIMGYGVMSTPAVVIDGKVVSTGRVLSVDEVKKLIKE

    >gi|310780418|ref|YP_003968750.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MKILIVGGVAGGASAAARLRRINEDAEIVMFERGEYISFANCGLPYHIGGVIKERDNLLVQTIEGMKTRFNIDVKIKTEI
    TKIDKENKKVYAKNLKTGETFEESYDRLLLSPGAAPFIPPIPGVNSPNIFSLRNMNDMDSIISHIEKNSVKRAVVVGAGF
    IGIEVAENLLERDIEVSILEKAPQVLTMVDEEIAAQVHQNIKDKEVELYLEDGVTQFEDIEGKTVVKLESGKKITADMVV
    MAIGVKPENDLAKEAGLETGKKGGVTVNKYLQTSDENIYAVGDAIEVKHYLSGEESIIPLAWPANRQGRIVADNMLGINL
    KAYNGSLGTSIIKAFDTTVAATGLNERYLKNAGTEYMVATVNRNSHASYYPGGVPITLKLIFTKDGDILGAQGLGCKGVD
    KRIDVIATAIKGKMKVWDLQDLELAYAPPYNSAKDPVNILGYVAENMINGEVETISYFQIEDYLKNNNAQLLDIRTKDEN
    ELGSIPNSTHIDLAELRDNLSKLDKDKEYLVY
    CQVGLRGYIAYRMLVQHGFKAKNLDGGYKLWQYTVMDQSNRDVFEKIN
    DFKHKEASCCGTVSELIDEEREMNKIIEVDACGLQCPGPILKTKKTMETIKDGEVLSIKSTDTGFKKDIATWAEKTGNKL
    LDVQLENGIVTAHVKKGSESKNLTPIAEKDTQTMVVFSGDLDKILASFIIANGALAMGKKVSMFFTFWGLNALRKENYTN
    KNKGVIDKMFGMMMPKGVNKLKLSKMNMGGMGTAMMKYVMKEKNVDSLEKLMKTYLENGGKITACTMSMDVMGIAKEELI
    DEIDYGGVASYLGDSQESYSNLFI

    >gi|310780427|ref|YP_003968759.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MTFDFDLIVIGAGAAGLTCAITAKGFGKSVLLIEKNRTGGECTWSGCVPSKALINISKEINSARKYCDFVPDTRKIMKDV
    KKVIEDVYSHETPEVLEKTGINFLEGEAEFTENKTIKIGENTFSGKSIIIATGSSPFVPPIPGINTVEYLTNESLFLLEE
    IPKSMIILGGGAIGVEMAQALNRIGVEVHLVEMLDNILFREDQEFAHILREKLIDEGVNIHIKTKAVEVKKNNNTIILTV
    EKDGQKSELSAESMLVAVGRKPSTASLKLENAGIEYNKKGIEVDKHLETNIHNIYAVGDVVGPYQFSHMANYQGIIAVQN
    ALTPLKKSIDYSNVAWTTFTQPELASAGMSEKEAREKHDNIHIYSLKRDELDRAKTKKDDIFNVKIICDHKKKILGAQIL
    ADRAGELICEIQAMKSNGLSLDKLAGVIHPYPTYAEAFSKLGKKAYVDKLMDNPVVSLIKSIKH

    >gi|310780428|ref|YP_003968760.1| Rhodanese domain protein [Ilyobacter polytropus DSM 2926]
    MKKILLVLSVMLFVIGCSNKSENPGEVSKKIEVLSTRKVKKSLKNQNTVLIDTRSYDEYNGWDIKETGIQGHISGAYNLP
    ASSLEHGDIEDFLDRKGITKDNEIILYGDDISMSEVLSDKGYNVYVYEKGIKEWTEKKNSIEKLPKYESLVPVSWVKKLL
    EGKEVPEYDGRPVKVINAGWGKKGKFHKNGHIPGSYYVHTGWFEVGPLWNRVSDENIKAELEKLGITKETLVIVYGEDPM
    PAARFAIICKYAGVEDVRVVNGGWKAWQEAGYSTEEGIEYPQPVDDFGTEVPGNPDIIIDLPEAENYLKSDQSDLVSIRS
    WKEYIGKTSGYDYIKPRGRIRGDKWGMGGSDPWHLEDYRAEYGTYMRPYNEILEMWEDLKINTDKNIAFY
    CGTGWRASEV
    LFYADAMGLDKVSLYEGGWKEWSENPETENEILKGEPEKLNEEKY

    >gi|310780447|ref|YP_003968779.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Ilyobacter polytropus DSM 2926]
    MKIIIIGGVAAGMSAASKAKRTLKDAEITVYEKTDVISWGACGLPYYIGGFFQSTNNMMARSIEKFRESGIDVQIKHEVL
    SVDHINKKIKIKKLVNGEIFEDSYDKLMIATGASAIIPPIKNVKLENVFTLKEFQDGVDLKDAVSREENKNIVIIGAGYI
    GIEAIEAMHHLGKNVRVIQLDNRVLPESFDKEITDIMENEILSYQNISLHLGETVKELKGEKQVKAVITDKGIYEADIII
    IATGIRPNTAFIKETGIEMLKNGAIIIDKQGRSSIEDIYSAGDCATVPHRVKNENVYIPLATTANKIGRVVGENLAGKNS
    SFFGTLGSAAVKVLNLEAGRTGISETDAKNMNINYGVVFIKDKNQTNYYPGQENIYIKLIYEKDSKVILGGQIVGKKGAV
    LRIDVIAAAIHNKMTTEDLGMLDLCYAPPFARTWDALNIAGNAAK

    >gi|310780542|ref|YP_003968874.1| SNARE associated Golgi protein-like protein [Ilyobacter polytropus DSM 2926]
    MKKLLVSVIFLLVFVIGVANENPTAVKNYDQYSNSKILISPEKANEMLTADKNIVVLDVRKEPDYNKGHIPGSYQIWRPS
    FSADKGEYEYGGMRATREKMAEVLGSYGVTGDTYIMLVSAKAEYDAARLWWILDMYGHEKMVLIDGGIDGWKNAGLPMVA
    ETSAKPESVKYEFPKSEDTSKFATIEDVKKSIGDDNTVVIDTRTDFEHDGLAQYKGAFAKGRIPSEYYVPWDKMVNEDKS
    FKSKEEMEAILAENGITRDKQIISY
    CQSGVRSAHMTFVLSQLLGWDNVKNYDGSWIEWSYNAVNGNVELEKTSLFKVFFS
    YMKSREKMEMLIGSLGVWAPAAYILMYALITITCISVLPITLVGGLVFGGVKGVIYTAIGASLGLSMAFLIARYIARKPI
    ESKFGNSEVFKKINEGVKNDGWFILATTRLIPVFPFGIQNYVYGLTSINFMQYSLLSTLFILPGTAVFVLLAGAVASGDK
    ATAIKMSLTASLIFFILTVITKIIAKKSKASVKSV

    >gi|310780544|ref|YP_003968876.1| Rhodanese domain protein [Ilyobacter polytropus DSM 2926]
    MKKLVALLMMVTLYAVSVAGGLITPEKLNKIKDKKDVVVLDYRWNKVPEKTIPGAMVVLNKEFSRERDGVKGMVLPKEEF
    ESFMSKMGIENKDTVVIVDDNGMMNATRLWWILNLYGHKGDVFILDGQIMAWEKSGLPMAAPSKPSKTSKYVAKDANPKL
    VATLEEVKASIEDNQMVVLDARSKLERIKGHIPNSVFIEWKENITKDGKYKSKAELKKLYRDSGITKNLKAIMPH
    CKSAV
    RSTQSMFALVEILGYDNVKNYDGSWLEYEAVKAPVKYGM

    >gi|310780545|ref|YP_003968877.1| Rhodanese domain protein [Ilyobacter polytropus DSM 2926]
    MVLNFFKRKSDGFKIVSVEEAKNLIEMKKDMILIDVRTEKENKFEGNIDGAILIDFLKLNHFKKELEKLDKELPYLVFCA
    IGGRSKAAAALMTKMGFNEVYDMAGGIKAWQKENNKNI

    >gi|310780599|ref|YP_003968930.1| alkylhydroperoxidase like protein, AhpD family [Ilyobacter polytropus DSM 2926]
    MRISVKELRDYPIFLKPFFWSQKKRYGKVLVPGLLWGRVPKLFAAVAVLYGVLIRKKSPISPVIRSIVTVRVSQINWCRF
    CVDINSSTLAKLTNSMDKVENLEKWRESALFDDKERTVLEYTEAVTYSDKEVTDEMIADLKKYFDEDGIVELTGLIAFQN
    LSSKFNSALDVAPQGFCKLPVENITHETR

    >gi|310780601|ref|YP_003968932.1| Heavy metal transport/detoxification protein [Ilyobacter polytropus DSM 2926]
    MKKIAIEGMMCGHCLETIEKKLKSIEGVEDVKVSLDEKAAFISGEIEDDLIKSAIEEEGYKVLSIEVIESHSKEEKEKRG
    FFSRLIRKIEKSNIEEFGEGKLHCCDPDKKEEDKKKH