Idiomarina loihiensis L2TR uid58087

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56459177|ref|YP_154458.1| thioredoxin related protein [Idiomarina loihiensis L2TR]
    MAEKMIVACPSCHKKNRIVVDKRNENAVCGHCRSLLFSGKIIVINSDEFRAHQSADMPLIVDFWASWCGPCQQYGPHFEQ
    AATNMRYDAQFLKISTEKEPHLAQQYAVRSIPTTLFVKNGQEVARQAGVMSASQIQQWVARY

    >gi|56459181|ref|YP_154462.1| O6-methylguanine-DNA methyltransferase [Idiomarina loihiensis L2TR]
    MSDYTRIEKAMTYMSGHVSSQPTLEDVAAHVHLSPFHFHRVFCKWAGTTPKRFLQALTLERSKRMLKGESSLMDVSLSMG
    LSGGSRLYDHFVKLEAVTPGEYKNEGQGVTIQYGVNETPFGKIFVAITPRGVCRIEFLGSRAVDEILTDLCKDWPKAALV
    SNENATNYVANVLFSRLKDGQSNPLSLHVMGTNFQVAVWRALLRIPPGKLASYSQIANVLDCPGASRAVGNAVGANPVAM
    LIP
    CHRVIQKSGALGRYRWGSAKKEMLQAWELLCEKPIEV

    >gi|56459191|ref|YP_154472.1| OsmC-like organic hydroperoxide reductase [Idiomarina loihiensis L2TR]
    MDILYKAVATSTGGRDGQSESDDGKLKVKLTTPKELGGAGGDGTNPEQLFAAGYSACFIGALKFAAGQEKVKLPKDTEVK
    AEIGIGQIEGGFGIDATLNIHLPGMSQDEAESLAEKAHQV
    CPYSNATRNNIDVRLNVTV

    >gi|56459261|ref|YP_154542.1| Fe-S cluster assembly scaffold protein [Idiomarina loihiensis L2TR]
    MSVETFVPSSSLISMTENAVRYFESRLKDEPGKLIRLSTKQSGCTGYAYVLDSVDAMEDGDEVVDINDNIKVAIASNALE
    LVRNTEIDYVKEGINGVVKFNNPNVVNECGCGESFNVQ

    >gi|56459322|ref|YP_154603.1| protein-disulfide isomerase [Idiomarina loihiensis L2TR]
    MNFIYKTFFVVAFIFSSNVFSQDLNPQQEEDLEKVEQLLRENPELIPNIHRGLQRFLEQQSEQKNAFANHQEWLYQSAAH
    PILGDQDAPHKIIVFTDYN
    CPFCKKLEPGLHKLIEEYPSIQVVNIFVPLRQQQVDGLKTNSALYGLNLWRNDPKAFFEAH
    NLMMKKSGMHTADSLQSVAQVTSTEAFLSPSGESEAVIRKNMSAFRDLGFRGTPTIIIGQQVMPGYIPYDKLEEIATTQF
    NLN

    >gi|56459323|ref|YP_154604.1| thioredoxin related protein [Idiomarina loihiensis L2TR]
    MSNSKVKPSWAKRLRTAALYIVLFSVVAFVVDAFRNSDVPESVPPELSSLTDINGEQYNLREMSKVSPVVLYFWATWCPV
    CPAVSPTVDYVGNHYPTISVALRSGDNHKLTRYAQAKGYEFPIVNDNLNRVSNGWQVSATPTIIIIENGDIVSATTGVTT
    PPGLFIRLWFHQFF

    >gi|56459324|ref|YP_154605.1| Thiol:disulfide interchange protein [Idiomarina loihiensis L2TR]
    MNKILPLWLVSLIAALLIYSAQSLAETPSTGWLSHEDHPPVSVKLELTGHYEAERNLLPALLHVELDEGWKTYWRSPGEG
    GIPPTFDWAKSANINDIEWHWPVPSRYSIQGIDTVGYQGSLTFPLMVQLSPDARQANISGTLTMSSCTTVCVLTDYPIDL
    HVDLDTLTVDSDRAFAFNQATGKVPREYDSNNVKQAIWSDANQRVQLTIERDSGWQNPQLFIHSNDETLADAEFSSPDIQ
    VESNSLTANVDVSHWLDLPDLNGAELIATVSDEKFAAEYKIQLTAGTIANNAPPLWAILLMALAGGLILNIMPCVLPVLG
    LKVQSLMLSGVQEPKVVRKQFFASSLGIISSFLVIALGLMALRWSGGSVGWGIQFQNPYFIAALVAITWLFALNLMGAFE
    FKLPSSLSTSAATAGDDSYKGHFLQGMLATVLATPCTAPFLGTAVAFALAAESSVILLIFAALGVGMALPWLLIAVFPRT
    AKLLPKPGRWMQWVKPVFAIMMLATTVWLTTLLKNFIGNELFLALTVGLSVLTLVIIGKVHGRKALFLSIGGFLVLAAVV
    GTTLILTADRWVNKLPQDHQWQPLTQQRIDEAVANGQTVFVDVTADW
    CVTCQANKVGVLLQDPVFTALGKEHVTRLRGDW
    TKANESITQYLKANNTFGVPFNKVYGPGAPDGITLPVVLSKDKVMDALEDAREQ

    >gi|56459345|ref|YP_154626.1| rhodanese-related sulfurtransferase [Idiomarina loihiensis L2TR]
    MQEIMEFVKSNPMMSGIWVVLLVALIVTTIRSAMSPTKNLEPQEATVWVNRGDGVFVDIRSPDEFKKGHIHGSVSLPMEK
    IKQKELSSIEKFKEAPIVIV
    CATGMTAKSAVSQLTAEGFTQVAVLQGGMNTWRSAKLPVSQKK

    >gi|56459379|ref|YP_154660.1| rhodanese-related sulfurtransferase [Idiomarina loihiensis L2TR]
    MELPIAVEHWQNGDAIFVDIRDPQSFAAGHISGSQHLDNSNLPQFLSSVDKNQKVIVVCYHGISSQGAADYIAGNGFTDV
    HSMDGGYTAWSMSFPEHTERN

    >gi|56459433|ref|YP_154714.1| soluble pyridine nucleotide transhydrogenase [Idiomarina loihiensis L2TR]
    MTAIKPETETEFDVVVIGTGPGGEGAAMQLAKSGYNVAIVEKHKALGGGCTHWGTIPSKALRHSVSRLIEYNNNPLFSGP
    GWQSGMTFSHILHYAESVIRKQVKLRSSFYDRNDVTVVHGTASFLDKNRIRVTKLDGSVDDLITKHVVIATGSRPYNPKD
    VDFSHPRIYDSDKVLSLSHEPKTILIYGAGVVGSEYASIFRGMGVKVDLINQRERLLSFLDAEISDALSYHLRNSGVVIR
    HNEEYESITGHDDKVVLKTKSGKTMAADCLLFANGRSGNIEQLDCQAVGLEPNYRGQLEVNENYQTSVDNIYAVGDIIGY
    PSLASAAYDQGRICASAIINGNCDKALISDIPTGIYTIPEISSVGKTEEELTEMKVPYEVGRAQFKHLARAQISGADVGC
    LKLLFHRETRELLGLHCFGERASEIIHIGQAIMEQKNGGNTIDYFVNTTFNYPTMAEAYRVAALNGINRLLL

    >gi|56459571|ref|YP_154852.1| dihydrolipoamide dehydrogenase [Idiomarina loihiensis L2TR]
    MSDKITTQVVVLGSGPGGYSAAFRAADLGLDVVLIERYSTLGGVCLNVGCIPSKALLHMTKHIEEAQHLAEEGIEFGEPK
    IDLDKLRKHKEKVVGQLTGGLGQMSKMRKVKVVNGYGKFTGSNTIKVEGDDGETEVKFDNAIIAAGSQAIKLPFIPHDDD
    RVWDSTDALELKEIPKKMLLLGGGIIALEMGQVYASLGSKVDVVEMTDQLVPPADADIIKNFNKQIKGRFENIMLNTKAT
    NVEAKKDGVYVTFEGDKAPKDPVKYDAVLVAVGRAPNGNKIDADKAGVNVDDRGFIKVDSQMRTNVDHIFAIGDVVGQPM
    LAHKAVHESHVAAEVISGKKHFFEPKVIPSIMYTNPEVAWAGVTEKEAKEQGIEYDAVTFPWSASGRAIASNAQQGMTKL
    IFDKNNRIIGGSMCGTNAGELLGEVCLAIEMGCDAEDIALTVHAHPTLHESVGLAAEIQEGAITDMPNPKAKKKK

    >gi|56459705|ref|YP_154986.1| cation transport ATPase [Idiomarina loihiensis L2TR]
    MSKSVRLSVEGMSCGSCASRVDKALNGLDGVEDASVNLASDSAEVTYSEKLSVDDLVQAVKNAGYEAHEVVDRDKQMREQ
    REQQAKEMRTLKGQLWLSTLLTLPVFILAMGNHMVPVFSEWVHNSLGLQTSWWIQLVLTTLVLAVPGARFYKLGVPALFR
    GAPDMNSLVALGATAAWGYSVVATVFPTWLPSESVNVYFEASAVIVTLILAGRFMEARAKSHTSDAIQRLMSLQSKTARV
    VRDGDVTEVDIAELGKGDEIEVRPGERIALDGEVSSGDSYVNEAMITGEAESVHKQKEDKVVGGTLNEKGTLRFKVTATG
    EGTVLAQIIRMVEQAQGSKLPIQDTVNRITLWFVPAVMLVALLTFVVWYFAASESALTFALVNAVAVLIIACPCAMGLAT
    PTSIMVGTGRGAEMGVLFRQGSALQALQQSKGVIFDKTGTLTEGKPTITEWMTLSEFDEKEVLTLAASIEAKSEHPTAEA
    LVNYAKEQDIKVSEPESFEAISGLGATGKVDSKTLYIGTSELMRDNDIGLDAEPADAKTWSEGGRTPIYVAIDGKLAAVF
    TQDDPIKASAKELIKRLHADGLKTAMVTGDAESTAKRIAKELGIDEVVANVKPDGKVDAVKRLKKQWGQVIFVGDGINDA
    PALASADVGFAIGTGTDVAIESADVVLMSDNLTVVQQAFALSEATMRNIRQNLFWAFAYNTALIPVAAGVLYPFFGILLS
    PMLAAGAMALSSVFVITNALRLKTVNLEK

    >gi|56459779|ref|YP_155060.1| thioredoxin reductase [Idiomarina loihiensis L2TR]
    MAEAKHCKLLILGSGPAGYTAAVYAARANLNPVMVTGMQQGGQLTTTTDVENWPGDAEGLTGPDLMVRMQKHAERFDTEI
    VFDHISSVDFSKRPFQLKGDVGEYTADSVIISTGASAKYLGLDSEEAFMGKGVSA
    CATCDGFFYKKQKVCVVGGGNTAVE
    EALYLSNIASEVHVIHRRDTFRAEKILVDRLHEKEQNGNVTFHLNKTLDEVLGDDAGVTGVRIKDTQDGSTEELEVAGCF
    IAIGHQPNTGIFDGELEMQDGYIQVQSGLQGNATATSVPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDALTKS

    >gi|56459816|ref|YP_155097.1| hypothetical protein IL0707 [Idiomarina loihiensis L2TR]
    MPIVFDNRFARKFPEITTRQPIKPDGEVNLRWLNSPLWAELTNGETPPAELSQWLGGLEHCPGSDPVAQKYAGHQFGHFN
    PYLGDGRGLLLGQAVVGDKITDIHIKGAGPTPYSRGADGRAVLRSSIRELLASEALHALTIPTTRALALISTQGKIQRER
    VEPGAMLARTATTHVRFGHFEHCFHRGLEDTMHNLWQDTIEVTWPHLADADIEEQFSQVVKSTAEMIAAWQAYGFIHGVM
    NTDNMSLAGETFDFGPYAFLDDYQPEKIFNHTDAGGRYGLLQQPGVGLWNLQRLAQAISPLIEADKLRAALDTYEPELRK
    AYLNRMTKRLGMSSVPAKERMQLVGGWLSLLEVNQADYQLAFRDLIDSLEAKEPKGLLAQSGDSWWQEYNNVVNGESDID
    VMKQVNPWVIVRTHHAQRVIEAAETGDDSLLHDYVQALMTPFSERLRESPWAKPPTAEEQVSELS
    CSS

    >gi|56459876|ref|YP_155157.1| thiamine biosynthesis protein ThiF [Idiomarina loihiensis L2TR]
    MLSNEQLLRYSSNILMKEIGETGQQRLLKSHVLIIGLGGLGCPASQYLASSGVGQITLVDHDTISLSNLQRQTLYSSDGI
    GLSKAWQAGHSLSRLNPDIRITAIEEKAYEGNLDALAEQADLVLDCTDNRETRYLINQSCYRLNTPLISAAARGFNGQLI
    ALNPGQSHGCYQCLYPDAVTEPLN
    CSNAGIAAPVVGIMGSSQALLAINYFTGHKLAWGYLQTFNGLSQNWQQLYLPRAAS
    CPVCGGQNAHSN

    >gi|56459933|ref|YP_155214.1| protein-disulfide isomerase [Idiomarina loihiensis L2TR]
    MRNLMSVVGLVGLVGASFSAPAISAEQSEVDTRHLNKIGIEVLSTEPGEIDGYVRAVTNQGMFYVSDDGERLISGNVFDI
    TGSEPENLSEAGMAKVRLKMLKGFADDMIVYPAEDEKYQVTVFTDTT
    CGYCQRLHENMDSYHAQGITIKYLAFPRGGMSS
    KGGKQLQTVWCADDKKGAITAFKEDENYSGDSSCSNPVAEHYQLGKSFGVSGTPAIVLPDGRLVPGALPASRLIAEIKKG
    ESQ

    >gi|56460154|ref|YP_155435.1| Na(+)-translocating NADH-quinone reductase subunit E [Idiomarina loihiensis L2TR]
    MENYINLFIRAVFIENLALSFFLGMCTFLAVSKKVKTAFGLGVAVIVVLGISVPVNNLIYHNILAPGALEWAGFPDADLS
    FLKFLTFIGVIAAIVQILEMALDKYVPALYNALGIFLPLITVN
    CAIFGGVAFMVERDYNFGESVVFGIGSGVGWALAIVA
    LAAVREKLKYADVPDGLRGLGITFISVGLIGLGFMSFSGVSL

    >gi|56460155|ref|YP_155436.1| Na(+)-translocating NADH-quinone reductase subunit D [Idiomarina loihiensis L2TR]
    MANVKEMKSVLFGPIFANNPIALQILGICSALAVTSKMSNTLVMCIALTAVVACSNLFISIIRNHIPSSVRIIVQMTIIA
    SLVIVVDQILKAYAYSISKELSVFVGLIITN
    CIVMGRAEAYAMKSTPFMSFLDGLGNGLGYSVVLLVVGFIRELFGSGSL
    FDVQILPLASQGGWFEPVGLLLMPPSAFFIIGGFIWVLRTFRTEQVEPKE

    >gi|56460208|ref|YP_155489.1| disulfide isomerase [Idiomarina loihiensis L2TR]
    MTKFRWFILFGPLVLFIGLVGFLLKGLGSDPTELNSALIDEPVPQFEVSDLYDTEVTYDQSVLHEGPLLLNVWATWCPTC
    RAEHEFLNELASRGVPIVGLNYKDDSREKAVNWLNTLGDPYTVNLFDPQGEVAFEFGVYGAPETYFIDHKGVIRYRHVGD
    VNERNWSNQLQGIYQQLLEEAE

    >gi|56460268|ref|YP_155549.1| mercuric reductase [Idiomarina loihiensis L2TR]
    MSLKKLLLLLIIVALFISAFAFDLTQYLSLDVLKEKQQQLNQLFVDYPFQVFAIYFVVYVASTALSLPGATILTLGAGAI
    FGLGWGLLLASFAASLGAFLAFLSARFILHDWVQEKFGDRLTAINRGMERDGAFYLLSLRLVPLFPFFVINLVMGLTKIK
    AWTFYWVSQVGMLLGTAVYVNAGTQLAQISSLGDVISADLIGAFVLLGIFPLIAKAVLAFVKRRKAFKGYKKPKSFDNNL
    VVIGAGSAGLVSAYIAATVKAKVTLIEKHKMGGD
    CLNTGCVPSKALLHVAELAHNARNASSAGVHVGEVSVDFKQVMQQV
    KSVIKDIEPHDSVERYTKLGVDVEQGDARIVSPWEVEVTSNVEGKSETKRITTRSIIIATGAKPLVPDFEGLDKVDYLTS
    DTLWELDELPKRLLVLGGGPIGCELSQAFQRLGSQVTQVEMAERLMGPEDADTVELLTRRLTAEGIDIRLNHKALRFEQH
    NGESVLIAEQTVDNESVDNQNADQSKDVEIPFDKVLIALGRQPNITGFGLEELGVQTNKTVSTNELLQTNFPNIYACGDV
    AGPYQLTHVASHQAWYASVNALFDPFKTFRADYSVIPWVTYTSPQVANVGLTEQQAKKADKPYEVTEYDIGELDRAIADD
    SAYGRVKVLTKPGKDELLGVNIVGPQAGELLAEYVLAMKYGIGLNKILGTIHSYPTLAEANKYVAGEWKRANAPQKLLTW
    VEKFHRWRRS

    >gi|56460273|ref|YP_155554.1| carboxymuconolactone decarboxylase [Idiomarina loihiensis L2TR]
    MSDFKLHDKESAPEESKKLLEGSEKAFGMIPNLHAVMAEAPGILNAYQQVHELFVNSSFDKDELTVVWQTINVFNECHYC
    IPAHTAIAKNMGADDSITDNIKAGKPLGDDKLEALRQFTLVMLEKRGNADESELESFYNAGYGQRQALEVTLGIAQKTMS
    NFTNHIANTPIDEPFKKFA

    >gi|56460326|ref|YP_155607.1| cation transport ATPase [Idiomarina loihiensis L2TR]
    MGVKTEDVSSSSIEELIIEGAGCASCVGKIESALKSVSGVENAEMNFAQRTVSVTGTASPSALVKAVERAGYSAKVATSE
    SDGDALAEKEQADWAYYKRLMREMTVALSLGVPLMIYSLFVGEMTVTTATERVTWLVVGILTLGVLYFSGKHFFVGAWQS
    LKNHSANMDTLIALGTGTAWLYSMVVVLVPHLVPEMARHVYFEATAMIIGLINLGLALELKARGRTSEAIKRLIGLQAKT
    ARVIRDDKQLDIAIEDVLEEDVVRVRPGEKIPVDGKVIEGSTTVDESMLTGEPMPVEKSVGDDVVAGTINKSGSFLFQAT
    RVGKDTALAQIINMVKRAQNSKPPIGRLADIISAYFVPVVMIIAVISALAWLNFGPEPALAFAVVSATTVLIIACPCALG
    LATPMSVMVGVGKAAEAGVLIRNGEALQTASKVSAMILDKTGTITLGSPKVTDVLVASEYDEQTVLQLAATLESGSEHPL
    AQAIVESARERGIKTSKVSNFNAIAGHGVEAEVDGKSLLFGNEKLLRERQVELGNFVEKAQGLAAEAKTPMYFAVDNELA
    AIIAVADPIKDDSVAAIKRLQDNGVRVVMLTGDNRATAEAVAEKVGIKEFFAEVLPEEKSKKVQELQMEGEIVGMTGDGI
    NDAPALAIANVGFAIGTGTDVAIESADITLMRGSLHGLADAVAVSKATLSNIKQNLFGAFIYNVAGIPFAAGVLYPFFGM
    LLSPVIAGAAMAFSSLTVVSNANRLRFFKAKKH

    >gi|56460337|ref|YP_155618.1| membrane associated glutaredoxin [Idiomarina loihiensis L2TR]
    MSQSTQKATLYRMSTPDHQCPFGLKTRHLLKANGYDVDDNLLESREETDKFKKKHDVDTTPQVFIGDKRIGGYEEVRAFL
    GKPLPDPDATSYRPVIALFTMTALLSVATSWLSFGRVFTVQTIEWFISFSMVVLALLKLQDVEKFSTMFLNYDLLAKKWV
    PYGRIYPYAEGLAGLLMAAEFAHVISIPVALFIGIVGSISVFKAVYVDKRELKCACVGGSSNVPLGFISLTENLMMVAMA
    VWMFFTMN

    >gi|56460372|ref|YP_155653.1| methionine sulfoxide reductase B [Idiomarina loihiensis L2TR]
    MSEHDWSNRNEQEWREILGDEAYYVLREKGTERPFSGKYLSCDKDGVYHCAGCGQKLFEAGHQFDAHCGWPSFDEAIKGS
    IDYVKDSSHGMTRTEILCSQCGGHLGHVFDDGPTETGQRY
    CVNSLAMRHEDDE

    >gi|56460391|ref|YP_155672.1| thioredoxin related protein [Idiomarina loihiensis L2TR]
    MSAFYLLTKPNCPLCTQAIQLLHSLDLEEPVELGVVDIAEQQELQEEYGWLVPVFIRGKDDAELRWPFDANQLLEFVEQ

    >gi|56460410|ref|YP_155691.1| cation transport ATPase [Idiomarina loihiensis L2TR]
    MECFHCLQPVPKGVNLAVEYKGSEKPVCCAGCQAVAQTIIQHNLHAYYEHRDTSQLQDSPVLPEELNDLDLYDNPDLQKE
    FVRHEGADTELATLTVENIT
    CGACGWLIERELLRLKGIQKAVVNVTSRRVQVSWSPAQLKLSDILRVLANIGYKALPFQP
    NEAEQQYARQRKSYIRRLGVAGIATMQVMMIAFGLYFGVVSDLSPDLQRFLWSVSLVFATPVILYSAQPFYAGALRALQA
    SRLNMDIPVSIALLGAYSASVYATITNTGEVYFESISMFTFFLLTGRFLELLAKERALKFATNRLTLLPKLANRETPEGY
    ESVAIKLLETGDIIRVKAGETIPADGELLNKQAQVDESLLTGESLPRSKKLGDAVIAGSINQHSPIRIKVTATAQQTVLA
    GIIAMQDSALAVKPKAQQVIDKLAGYFIAAILTVAVITYFSWWWIQPDHALWVTLAVLVATCPCALSLAAPTALTGIIHR
    LNRDGILLKGSDVLESVKQLNKVCLDKTGTLTEGKFRLVERNDYIDSNTVDELISGLELFSEHPLSVPLSQLSDTPASFQ
    DVTNEMGFGLQGEFNRQSYRAGSEIYIQQWHPEFKATNKHQVVIASKERILAEFRVEDQIREDAAETINWLKSNGYQPII
    LSGDSESRVQSLAHELGIPEYHSALKPAEKLAFVTAQQEAGHTVWMVGDGINDSPVLAKADLSMTFSQASDLAQTAADVV
    LMSESLNQIKVVIESALKTRQIMKQNFIWALVYNVSVLPVAAIGMIAPWAAALGMSLSSLLVIGNSLRLYRK

    >gi|56460474|ref|YP_155755.1| glutaredoxin 1 [Idiomarina loihiensis L2TR]
    MFTVIFGRPGCPFCVRAVEVADKLKADMEDFDYRYVDIHAEGISKADLEKTVGKPVQTVPQIFVDEQHVGGFTEFEAYAK
    ENLGLYTA

    >gi|56460562|ref|YP_155843.1| glutaredoxin family protein [Idiomarina loihiensis L2TR]
    MLRVYGIKNCDTVKKSLKWLDKNEVAYEFIDVRQQPLQKETVSGWLQKLPAESLLNKRSTSWRNLSDEQKSVVDANAIAE
    LVAEQPTLFKRPLVESGQAVHCGFNEKLWSERYL

    >gi|56460569|ref|YP_155850.1| thioredoxin-dependent thiol peroxidase [Idiomarina loihiensis L2TR]
    MQTLQQGDKAPDFTLPDANENSVTLSELLKENRVLVYFYPKAMTPGCTVQAQNLRDSRKQLEEFNVVSVGISPDAPKRLA
    KFTDRDELNFTLLSDEDHKVAEDFGVWGLKKFMGKEYDGIHRISFLVEQDGSISKVFNKFKTKEHHEVVLEHLKQA

    >gi|56460572|ref|YP_155853.1| thioredoxin related protein [Idiomarina loihiensis L2TR]
    MKLRTLVCAAAAVLITACSQEPDVVTDADNEFRWGDLGEKTVVVNYFAEWCAPCLRELPELNEFNQHKAKDVELVGVSFD
    PMSNAELAELKQRHGIEFQLALMEPAPKFPFQRPQMLPATYVIKPDGSVKGPLMGEQDLESLENAVNSH

    >gi|56460573|ref|YP_155854.1| glutaredoxin family protein [Idiomarina loihiensis L2TR]
    MSQVTIYHNPRCSKSRQTLELLKQNDVEPEVVEYLKTPPNAAELKDILEKLGLSADQLMRKKEDAYKELGLAGINNEDEL
    ITAMVNNPKLIERPIVIRGNKAAIGRPPEAVLDIL

    >gi|56460631|ref|YP_155912.1| bifunctional methionine sulfoxide reductase A/B protein [Idiomarina loihiensis L2TR]
    MSFRLIIVIVGLLVSCFSMAQNSEPTKQKNEKVATFAGGCFWCVEEAFEQMPGVREVISGFSGGDEVNPTYEEVSAGKTG
    HTEAAQIYYNPDVVSYAALLQKLWRISDPTDNDGQFVDRGKQYRPAVFYHNDEQKRIAMESREWLDKNGPFPDPVVIEIT
    PFKSFYKAEEYHQDYYDKNPVRYRIYTYNSGRYDFVEKHWGDTSDVDYQQFTNDNPTGKAEQQSFVKPSDSELKKRLTDI
    QYAVTQEDQTEPAFDNRYWDNERKGIYVDVVSGEPLFSSADKYESGTGWPSFTKPISPDAVVEKDDSSWFYTRTEIRSRK
    ADSHVGHVFNDGPPPTGLRY
    CMNSAALRFIPLEKMEEEGYGDYIPAVTDD

    >gi|56460745|ref|YP_156026.1| putative mercuric transport protein [Idiomarina loihiensis L2TR]
    MSNSKSGRGSLLAGGIAATLASACCLGPLILLALGVSGAWIGSLTALEPYRPIFITIALIAIFFAWRRIYRRADDCNPDN
    TCATPNARKSYKVMFWLVAVLTLTALAYPYVVPLFY

    >gi|56460746|ref|YP_156027.1| periplasmic mercuric ion binding protein, MerP [Idiomarina loihiensis L2TR]
    MKKTMITTILFLLFSMPALAVEKTVTLSVPGMTCVTCPITVKAALGQVAGVSAVDVRFEERDATVTFDDEKTSVKELTEA
    TTNAGYPSTLKATAAKNQS

    >gi|56460747|ref|YP_156028.1| putative mercuric reductase [Idiomarina loihiensis L2TR]
    MSSNNLHIAVIGSGGSAMAAALKATEGGARVTLIERGTIGGTCVNIGCVPSKIMIRAAHIAQLRRESPFDKGLSTHTLKV
    NRSTLLEQQQARIEELRESKYQSILRENSAITVINGEARFIDDETLSVSLCDGGEQTVHFDRAFIGTGARPAQPPIPGLA
    ETPYLTSTSALELNDIPKSLLIIGASVVALELAQAFARLGSDVTVLARSRVLSQDEPAIGEAIATVFDREGINVLEHTEA
    SEVRYDGQHFILKTNAGTLKAEQLLVATGRTPNTENLDLKTIGVQTERGAITINDRMQTSNSRVYAAGDCTNQPKFVYVA
    AAGGSRAAINMTGGDAHLDLSAMPEVIFTDPQVATVGLSEADAKTGGYVTESRTLGLENVPRALVNFDTQGFIKILAESG
    SGRLLGVQVVAGEAGELIQAAVMAIRAGMTVNELADELFPYLTMVEGLKLCAQTFTKDVKQLSCCAG

    >gi|56460796|ref|YP_156077.1| rhodanese-related sulfurtransferase [Idiomarina loihiensis L2TR]
    MITAQELCGKAKSNVKEVNTEELQKAIEQGARVIDVREPAEYGQGHIRQAVNMPRGVLEMQLNQHPDVAGYDNALERIAE
    KPLYLI
    CRTGGRSALAAESLQRMGLDNVYSVDGGMSAWQENKLPVVAGE

    >gi|56460894|ref|YP_156175.1| Na(+)-translocating NADH-quinone reductase subunit E [Idiomarina loihiensis L2TR]
    MTDYLLLLIGTVLVNNFVLVKFLGLCPFMGVSGKLDTAIGMSAATTFVLTLASVCSYLVNQYLLEPLDLMSLQTLSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNEQHNFVQSIVYGLGAAIGFSLVLILFSALRERLAA
    ADVPVAFKGSAIAMITAGLMSLAFMGFSGLVSA

    >gi|56460895|ref|YP_156176.1| electron transport complex protein RnfB [Idiomarina loihiensis L2TR]
    MSLFGAVIALGILALIFGVILGFAAVKFRVESDPIVDQIDEILPQTQCGQCGYPGCRPYAQAIADGDDINKCPPGGEATI
    KQLADLMGVEAKPLDDAHGEEDVKKVAVIREDECIGCTKCIQACPVDAILGAAKQMHTVIEHECTGCDLCVEPCPVDCID
    MVKVKARPETWQWDLDTVKENIKANSIPVKVVE

    >gi|56460899|ref|YP_156180.1| SoxR-reducing system protein RsxE [Idiomarina loihiensis L2TR]
    MNEYKHLTKQGLWDNNPALVQLLGLCPLLAVTASVTNALGLGLATLFVLVGSNITVSLVREFVPSEIRIPVFVMVIATFV
    TIIQLLMNAYVFQLYQSLGIFIPLIVTN
    CAIIGRAEAYASKNPWQRAAFDGLAMGAGFALVLVVLGAMREIIGNGTLFNG
    AELLLGDWAAQLRIELFTVNYPLLLAILPPGAFIGMGFIIALKNKIDAVRSARAEKKTVTRARVTA

    >gi|56460903|ref|YP_156184.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR]
    MSVLVGRKAPDFTAAAVLGSGEIVEDFKLSDAIKGKKAVVFFYPLDFTFVCPSELIAFDKRLDEFKKRGVEVIGVSIDSQ
    FTHSAWRNTSTDAGGIGQVKYPLVADVRHSICKAYDVEHPQAGVAFRGSFLIDEEGMVRHQVVNDLPLGRNIDEMLRMVD
    ALNFHEKHGEVCPAGWEEGKEGMKENAEGVASYLSKNADKL

    >gi|56460904|ref|YP_156185.1| glutaredoxin-like protein [Idiomarina loihiensis L2TR]
    METVDRIKQQIEENPILLYMKGSPKLPSCGFSSQASQALMGCGQAFAYVDILQNPDIRAELPKYANWPTFPQLWVEGELV
    GGCDIIMEMFQNGELQELVSEVAERHPEPSAE

    >gi|56460922|ref|YP_156203.1| disulfide bond formation protein [Idiomarina loihiensis L2TR]
    MLSVGQWPNKPFAWLLLFLGCSGLLGAALYFQMVLNLEPCVKCVYQRMAVIGIGLSAIVGLFGSGLWLTRWAALIGWLYS
    SYQGLLIAYDHWDLQTSKNAFFAV
    CESAPNFPDWAPMHEWMPGLFAAPGLCGDIDWQWLGLGMPGWMTVIFAGLLLIGII
    VTICHIISSFTKKDGLVLYHK

    >gi|56461094|ref|YP_156375.1| thioredoxin domain-containing protein [Idiomarina loihiensis L2TR]
    MSESNIVNLDLQNFQQVLLEGSKEKLIIIDFWADWCEPCKQLMPVLEKLAMQYSDQVILAKINCDEQQELAAQFGIRSLP
    TVAFFKDGQPVDSFGGVKTEGEIQEILTKHLPSPSDDLIQQAQTAMGEGDANTAYTLAKQAYDLDNTNMQALKLLAEAAV
    DAGRLDQAKELVAKIPLVEQDGDYQRIKGKLELAEDAADSPELRALQEQVENTPDDLALKLQLALKFHEASRDEEALQQI
    FTVLGKDVNFADAKKYALDIINSLPDGDPLAATYRRKLYSTMY

    >gi|56461139|ref|YP_156420.1| peptide methionine sulfoxide reductase [Idiomarina loihiensis L2TR]
    MANNEYEQATLGGGCFWCVESAFLQVKGIQSVKSGYTGGHTIDPTYEQVCSGETGHAEVAQLQYDPEQISYRQILEIFFT
    LHDPTQVNRQGNDVGTQYRTSIFYHNDAQKREAESIIAELEADAAFAAPIVTEVTELGTFYPAENYHENYYARNPENPYC
    QAVISPKLAKFRKTFAGLLKD

    >gi|56461169|ref|YP_156450.1| thioredoxin related protein [Idiomarina loihiensis L2TR]
    MKTDDIGSNSDYAEEAFTFEQTGELSGNVVLEFGAPWCGHCQAANPAIKEAITERAGLRHIKIYDGKGKPLGRAFKVKLW
    PTLILLHNGNEVARLVRPLRSDEVREFISEVD

    >gi|56461281|ref|YP_156562.1| OsmC-like domain-containing protein [Idiomarina loihiensis L2TR]
    MEINVNFLDNMRLEAKFDDFTVISDQPIRYKGDGSAPGPFDYFLASSVMCAAHFIRLYCDARDIPTENIRVSQNNVVDPE
    DRYKQLFKIQVELPADISEKDRKAIIRAAERCAVKRVIENDLEFDVEAVESITQDAQALLTIRPDSDSRTYIEGKDLPLE
    QTIANMTAILADLGMKIEISSWRNIVPHVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLSCNFFYNDQYFGEE
    IANAEFVHYPNEKWFKPGTNDELPTEILDEYCRELYDPEGELRGSHLIDTNSGRADRGIVSLPFTRHSDGETVYFPSNLI
    ENLYLSNGMSAGNTLPEAQVQCLSEIFERAVKKHIIEEEIALPDVPQEVLNKYPNILEGIKALEEQGYPVLVKDASLGGQ
    FPVACVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPAPTFNSMAVTEPNNFVEHFIDSSGVVSWRF
    FSAKSDIEFVEWDFSGSNQEEADTLFGILQDMGKEAYIAVHEDLGAPVCRILVPGYSEVYPVEDLIWDNTNIALQYREDI
    LNLHRLTDDQLEDLVERLEDSQLDNYMDIITLIGIEFDENTVWGQLTILELKLLIYLALQRHDDAFEYVEMFLQFNDNTV
    ERTLFYRAIEAVLEITLDEELELDDYRYNLGRMYGEETIEAVIGSVNGTTRFYGLTPTNMQLEGLDRHLRLIESYKKLHA
    ARAERQV

    >gi|56461340|ref|YP_156621.1| HesB/IscA family protein [Idiomarina loihiensis L2TR]
    MSSAAEQAMPIEFTEQAASKVGKLIAEEENPNLKLRVYVTGGGCSGFQYGFTFDEKKNPGDMEIEKNGVTLLVDPMSLQY
    LMGGVVSYEEGLQGSRFFVDNPNATTTCGCGSSFSV

    >gi|56461383|ref|YP_156664.1| thiol:disulfide interchange protein precursor [Idiomarina loihiensis L2TR]
    MIQRFITCLAALTLVFAVVAPAHSVQSNPFQQDNQFLSVDQAFDFDSEVNDSKVTVSWVVAPEYYLYQHRFKVVPENALA
    AEPELPQGESHNDEFFGESIVYRNYVEWSFTLNPEFSGDTITVQYQGCADAGLCYPPTEKQIKLSSTSETAPATAPPNTD
    SSLFGIGEQHLIITLLLFFALGIGLAFTPCVFPMYPILSGVVLGNRERNWKNTLWLSFIYVQGMAITYSLLGLVVASAGM
    QYQAYFQHPVVLIVLAVLFALFALSMFGAYTLQLPISWQSKLQSFSGQQSGGNIVGVFIIGAISGLVASPCTTAPLSGAL
    LFIAQSGDMVSGVAILYALSLGMGVPLILFGLSGGKLLPKAGAWMNVVKQFFGWLLLAVTLFLIERLIPTSISMWLWIFY
    FILAAVSLAVSISQPLRITTKVITIVLLAAAATTGSYWQVNKAQLEQKSHGLFTVVSNVSDIQQQVAESDRWVMLDLYAD
    W
    CVACKEFEQYTFSDEQVQAQFQEFKLIQADVTRNNAQDVEILSRYKVLGLPTILFFDPEGNERPEYRVTGYMNAEDFKK
    HLEKIVSE

    >gi|56461429|ref|YP_156710.1| glutathione reductase [Idiomarina loihiensis L2TR]
    MSRHYDYLAIGAGSGGIASANRAAIRGAKAAVIEAKHVGGTCVNVGCVPKKVMWYGAHIAEAIKYSPSYGFELEQKGFDW
    ATMVKNREAYIERIHGGYHRGFQGNGVEFIEGFAKFVDHKTVEVNGEKITADHITIATGGRPMIPEIPGAEHGIDSDGFF
    ALTEQPKKAAVIGAGYIAVEIAGVFHALGTDTHLMVRRDRPLRTFDKDITDGLLERMKQDGPELHTETTVREVVKQDDGT
    LTLHFEGGQTMDGFDCLVWAIGRVPSTDKINLECTGVELDSEGFINVDKFQNTNVQGIYAVGDNTGAAALTPVAIKAGRL
    LAERLFNNMPNAHMDFENIPTVVFSHPTIGTVGLSEEDAKLKFGEDNITVYKSSFAAMYNAITPHRALSYFKLVCHGKEE
    KVVGIHGIGEGMDEILQGFAVALKMGATKADLDSTVALHPTSAEEFVTLK

    >gi|56461442|ref|YP_156723.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR]
    MTLRIGDTAPNFTIDTTQGSIEFHDWAKGSWVFFFSHPADYTPVCTTEMGRTAQLAPEFEKRNVKPLGLSTDTVEAHKGW
    INDVNDTQNTLLEFPIVADKDLEVAQLYDMIHPNESATATVRSVFIIDPNQKVRLIMTYPMTVGRNFNEILRVIDALQTT
    DRDEVACPADWLPGDSVIIRPTVSDEEAKEKFPQGWKTLRPYLRLTDIK

    >gi|56461451|ref|YP_156732.1| rhodanese-like sulfurtransferase [Idiomarina loihiensis L2TR]
    MYICAALYKFVELNDYKELREPLYQTLIANDVKGTLLLAREGINGTICGTREAIDNVLNYLRSDERFADIEHKESPSDEQ
    AFYRTKVKLKKEIVTLGVDWVDPKSSVGTYVDPEKWNDLIADPEVLVIDTRNEYEYAVGTFEGAINPKTDTFREFPEYVK
    QHLDPEKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLKGGILKYLEMMPEDNSRWNGECFVFDQRVTVKHGLEQGEYD
    QCYACRMPITAEEMQSEHYQKGVSCPHCYDKTSTEQKERFAERERQIQLAKARGEKHIRDGKLESLS

    >gi|56461462|ref|YP_156743.1| thioredoxin [Idiomarina loihiensis L2TR]
    MSDVIVQLSDDSFDADVINSDKPVLVDFWAEWCGPCKMVAPILDDIASEYADKLVIGKLNVDHNEQTPPKYNIRGIPTLL
    LFKGGEVVGTKVGALSRAQLTEFLDQHI

    >gi|56461578|ref|YP_156859.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR]
    MSQQIKEGDKVPSGSLTSKGDLGIQNYDPAEIFAKGTHVLFSVPGAFTPTCSEKHLPGYVEHAEALKEAGVLSINCVAVN
    DAFVMKAWGESLGIGEKVRLLSDGNGAYNQIMGLSMDTGNFGGIRSKRYAMIITDGQVKGLFVEEDKSFEVSKAEYILEQ
    LQK

    >gi|56461650|ref|YP_156931.1| organic hydroperoxide reductase [Idiomarina loihiensis L2TR]
    MKRSANAQWKGSIKEGSGVVSTQSGVLDSTQYSFKSRFEEGKGTNPEELLGAAHAGCYAMAFSLMLGESGYEPDSIDAKA
    EVSLEEDGDGFSIAKIHLKVKASIPDIDEDKFQKLAEKAKEG
    CPVSKVLKAEISMDASLS

    >gi|56461671|ref|YP_156952.1| disulfide isomerase [Idiomarina loihiensis L2TR]
    MKKWLMGFAGALMVAAGFAQAQNFEEGVHYEVVADEATSKPEIAEFFSFYCVHCYRFEPIAKEIKSEYPDAFKKAHVSFL
    GPRNMGETMTQAFVVAQKLNKEEEIAAAIFDYNFNKNSMLTSKQDIRNVFIVNGVSGDEFDKAMASFTVRAAASKMDRRA
    SNLGVNATPTFIVNGKYKMLPQGFRDSDNFQEDFSDLAGYLLEK

    >gi|56461676|ref|YP_156957.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR]
    MLTVGDKLPEFSVIAAKPKFNMPEENGESAFETIDNNSFEGKWKIIFFYPKDFTFVCPTEIVEFAKLNEDFADRDAVVMG
    GSTDNEFVKLAWRREHPDLDRLNQYSFADDGSLVDGLGVRDKAENVALRATFIVDPHNVIQHVSVNNLNVGRNPAEIVRI
    LDGLQTDELCPCNRALGGDTL