Hyphomonas neptunium ATCC 15444 uid58433

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114800218|ref|YP_758854.1| methionine-R-sulfoxide reductase [Hyphomonas neptunium ATCC 15444]
    MFTRRLFLASSALGLAACTAASAKDLSKNTETAGYAGDEWRQLSEADWKARLSPAAYEVLREHGTERPFSSPLDKETRAG
    MYHCAGCDLALFSSEAKFDSGTGWPSFWEALPGAMGMSVDRRLFYPRDEYHCARCLGHQGHVFDDGPAPTGKRW
    CNNGVA
    LTFKPA

    >gi|114800416|ref|YP_759138.1| pyridine nucleotide-disulfide oxidoreductase [Hyphomonas neptunium ATCC 15444]
    MSELRTLKADLAVIGAGSAGLSAAAGAAMLGLKVVLFEKHEMGGDCLNFGCVPSKALISAAKIAHVPEEAVRYGISLPPA
    VVNWDAVKAHVRGAIETIAPIDSQERFEGLGCTVIREAARFEDKNTLVSDSVRVKARRIIISTGSRAIIPPVPGLEDVPY
    FTNETIFSAPDFPHELIILGGGPIGLELAQAFSRLGSKVTVVEMGRALPRSDAAHAKIAVDAVRAEGVTILEGHKATRIS
    GGPGNISVKAEGPEGDVMIAGSHILIATGRQAVTDGLDLEKGGVDFTNKGVTVSDTLRSKSNPRVWALGDIAGHGQFTHL
    AGWHSSVFVRRAFFKQGSKASSLPLPAVTYTSPEVAQVGLTEAEAREKFGDAVKTSAFPFHDNDRAIAEAKTLGEAKLVI
    HKGKLVGASIVGEGAGDIIQMVGLAMSNGLKLTALTNFISPYPTRTEVVKRAASAYFTPSVFGAPARTLVGILQKIP

    >gi|114797052|ref|YP_759277.1| thioredoxin-disulfide reductase [Hyphomonas neptunium ATCC 15444]
    MAETQHAEILIIGSGPAGWTAAVYAARALRDTLVVTGMQPGGQLTITTEVENWPGESHIQGPELMVKMQEHAEKMGAKVA
    NDHIASVDFETRPFKAVGESGTVYTADSVIISTGAQAKWLDLPSEEKFKGFGVSA
    CATCDGFFYRGKEVLVIGGGNTAVE
    EALFLTNFASKVTVIHRRDHFRAEKILQDRLFKNPKVEVIWNHALEEVVGDENPLGVTAARIKDVTTGAIRELPVHGVFV
    AIGHAPSTELFVGKLPMRESGYLITEPGSPRTAIPGVFAAGDVTDETYRQAVTAAGMGCMAALDAERFLSEQEAHVEAAV
    PAE

    >gi|114799468|ref|YP_759435.1| glutathione-disulfide reductase [Hyphomonas neptunium ATCC 15444]
    MTDTAYDYDLFVIGGGSGGVRAGRIAAQAGAKVALAEEYRMGGTCVVRGCVPKKFMVYSSTYGKHIKLSAGYGWSVGDVS
    YDHSAFMVALHAEVERLSAIYDRNLKNAGVDVFDDRAEFVDAHTLRLKKSGKTVTAGKILIATGGRPWMPSADELPGIEH
    AIDSNGVFEMDTLPKRMLIAGGGYIAVEFAHIFAGLGAEVTLVYRGETVLRGFDDEIRLAVHEGLKEAGVRVVTKCTFKS
    IEKTGGGLMVTMSSGNEIDTDVVLMAVGRRANTDDLGCDKAGVKLAEQGEVIVDEWSRTNVENIWAVGDVTGRVALTPVA
    IREGHAFADTEFGDKPWKMDHSNIPTAVFTQPEVGTVGISEAEARKTFGEIDIYKTKFRPMKNMLNGDQTRTFMKLVVRA
    SDQRVLGVHVVGEDAAEMIQTAAIAVKMGATKQDFDQTCALHPSSAEELVTMRTKWVPEGV

    >gi|114799478|ref|YP_759715.1| arsenate reductase [Hyphomonas neptunium ATCC 15444]
    MIVIHHNPDCGTSRNVLAIIKASGAEPVVIDYLKEGWTRPQLLGLFAAAGLTPRAALRESKSPAKELGLLEPGISDEAIL
    AAMLEHPILVNRPLVCSPKGVRLCRPSEAVLDLLESLPPGPLYKEDGEMIIDEKGQRIG

    >gi|114800089|ref|YP_759774.1| anti-oxidant AhpCTSA family protein [Hyphomonas neptunium ATCC 15444]
    MAIKVGDKLPEATFMEMTVDGPKPVTTAQVFGGKTVALFAVPGAYTPTCSARHLPGYVDKAGDFKAKGVDEIVCTSVNDV
    FVMGAWGKSSKAEEAVRMLADGNGAFAQSLGLELDASGFGMGKRSQRYSMLVKDGVVAELNVEQGGEFKVSAADYLLGQL


    >gi|114797442|ref|YP_759884.1| methionine-R-sulfoxide reductase [Hyphomonas neptunium ATCC 15444]
    MAKPKIQRSEREWREMLTDQEYAVGFQEGTERAFTPGNYESEKRKGVYHCKGCETPLWSSEHKFDSGTGWPSYWQPIGEG
    VVATKTDFKMIYPRTECHCANCGMHMGHVFKDGPPPTGQRW
    CINGIVLDFRPEGE

    >gi|114797319|ref|YP_759944.1| copper-translocating P-type ATPase [Hyphomonas neptunium ATCC 15444]
    MTGLALDTNGCPSGLAPPSGSDTSDPAAFVRKVGKQSRLSLTVRGAKCGGCLSRIEGAVSALPGVESARLNLSSGKLEIA
    WSGNLEPRRISEAVSSLGYGVAPLNTATEDDGHKKEEQSLLLAMGVAGFATANIMLLSVSVWGGHEEMGEATRQGLHALS
    GVIALPTLIYSGRPFFRSAWNVLKKRRTNMDVPISLALILAFSVSVAETLRGGEHAYFDAACMLLFFLLIGRFLDARVRR
    RAWSAARDLAALASRTVMRIGADGAPVSARAEDIRPGDSILLAPGERAVVDMVIEGGESEVDESLVTGESLPRWTGTGMK
    LMAGAINLSQPLTGRATAAAADSLLAEISQMLTAGEQKRSAYRQIADKAVSLYVPLVHSTALLTFLGWWLVGGMGLREAI
    LVAVSTLIITCPCALALAAPVVQVVAAGRLFRGGAYLKSGDALERIAACDHVIFDKTGTLTLGTPRLVSTGIPAALIGDA
    AQLARASRHPLSRALTAAAGPGPLGTDVKERPGLGLEGMVGGVACRLGSAEWTGAAATGHVGATLFFARGEEAPVELRFE
    DDIQGDAAGMLAKLSAMGMTMEIVSGDRAEAVAEVARALGIDQWTAGASPQDKVARLEALQAQGRKVFMVGDGLNDAGAL
    ALAHASAAPGGALDVSQSAADAVYSGGLAPLPRLVKTARTAKAVMLQNFGFAAAYNLVAVPIAVLGHATPLVAAIAMSGS
    SIVVCLNALRINLNTEKAV

    >gi|114797219|ref|YP_760084.1| putative frnE protein [Hyphomonas neptunium ATCC 15444]
    MTVAIEMVSDPVCPWCWLGLRRIQAAIAQTPDIKVQLLFRPYELDPTIPAAGVDYKEYMGSRVSSPEGKERMAAMRQALI
    DYGAAEDIPYRFDAVTHRPNSFDAHRLVRWAQGQGKGAEAKEALFRAYFNEARNIGDHGVLVDIARSIDLDADIVADLLK
    TGADTDIVRQEADTFRQMGISGVPTYIANRRVAVQGAESAEKLERFIRHAAAQLPQERPAG

    >gi|114799712|ref|YP_760098.1| hypothetical protein HNE_1381 [Hyphomonas neptunium ATCC 15444]
    MPERSEKLETVKTAHLYLMIMPGHTCPYGLKAKDLLKRSGYAVEDHPLTSRDEVDAFKAKHEVETTPQIFIGGERVGGHD
    DLRRFLGKRVVDPKAPSYRPVIALFSITLLMALAASFAVYGTPLTVRAAEWFIAFSMAILALLKLQNVESFATMFLNYDL
    LAKRWVRYSYIYPFAEGLAGILMIAGALTWLSVPVALFIGTVGAVSIIKAVYIDRRELKCACVGGGSNVPLGFVSLTENL
    MMIAMAVWMALGAFGLLPGWAHSM

    >gi|114797517|ref|YP_760136.1| putative sulfurtransferase [Hyphomonas neptunium ATCC 15444]
    MSESGDPLVSADWLMANISAPDVRIVDATWFAPWTDPPETAHDLWKRGHIPKAVYFDIDDIADLNSPYPHMLPDAVKFSS
    RVRKLGLGDGSRIVVYDQNRFFASARAWWMLRVMGHKDVHVLDGGLHAWVTEGGALDDLPTPPGERHFTPRVRSDLIMDA
    RGMEQLVGSARVRIIDARPDGRFFGRDPEPRPGMPSGHIPGSINVPGNLLVTEDGRMKSASELARLIPEPAKPTVAT
    CGS
    GVTAAITALALARLGNWDVAVYDGSWTEWVSDPARPIAKG

    >gi|114798313|ref|YP_760395.1| mercuric transport protein MerT [Hyphomonas neptunium ATCC 15444]
    MSDKTNGSGNDRRSSWLIAGGVLGTFLASSCCILPLILISVGVTGAWIGQLTLLEPYKPVFMLIAAGFLAAGFWEVYFRK
    GKHCEDGSDCARPAPSWIKQVALWGGALIVFAALTIETWAPLFY

    >gi|114797310|ref|YP_760396.1| mercuric transport protein, periplasmic component [Hyphomonas neptunium ATCC 15444]
    MGGMALAGAQFSQTEVAEVQQATARFSVDNMTCATCPISVKKAMLRVDGVKSVEIDFGTKTAEVVYDPAITSPETIAAAS
    AGVGYPAVQTS

    >gi|114799977|ref|YP_760397.1| mercuric reductase [Hyphomonas neptunium ATCC 15444]
    MKHECCAPNCEYDLAVIGAGSAGFSAAITAAEGGVRVALIGHGTIGGTCVNVGCVPSKTMIRAAEAVFSAQSAHRFPGLR
    GEAQVSDWAALIAAKEDLVASLRQKKYANLLPGYHGVTYIDEGPARLVLGGVEVGGRKIKVSKVIVATGGRSAVPDVAGI
    SEVPTLDSTALLELKALPESLIFLGGGYIGVELAQMMARLGTRVTIVCRSRLLPRAEPEVSEALAKALRAEGISVVEKVT
    YDAARLDGSRTVVTVTVNGAARDLAADHLVLSTGRIPNTDGLGLKEMGVETDQRGAIIVGDDMATTRSGVYAAGDVTDRD
    QFVYMAAYGAKLAARNAVLGGKECYDNAAMPWVVFCDPQIAGVGLTEAQAYAAGYDVKTSVLPLENVPRALAARNTTGLI
    KLVADRANDRLLGGVIMAQEGADSIQTLSLALKFGMTTKALGETIFPYLTTVEGFKLAAQTFDKDVAKLSCCAG

    >gi|114798336|ref|YP_760583.1| thioredoxin [Hyphomonas neptunium ATCC 15444]
    MAAINVNEDDFDGVVTESETPVVVDFWAEWCGPCKQMSPHLEAVSEEMTGKVKIVKVNVDDYPLVGARYGVRGLPTLLMF
    KGGKVTATRNGAMNRQALTDWIKQSL

    >gi|114798923|ref|YP_760617.1| DSBA-like thioredoxin domain-containing protein [Hyphomonas neptunium ATCC 15444]
    MLTLSRRFAAVAFSALALVACGAAGDGAGTSGANPSEANADGELGHVLGQADAPLTIIEYASPTCPACKYFHDTVKPTIE
    EKYISTGKVKFVFREYPLNEIDVAAYAMARCAGDDKFFDVLDDLFENQEGIRYAAQNGVVKTTLGAIGQRHGIADTATFE
    ACLSNSEIRQALADTYATSEKWGVEGTPTFIIDGVKHNFQGEYTTAEGFSKQIDAKLAELGAQ

    >gi|114799856|ref|YP_760650.1| glutaredoxin-like protein [Hyphomonas neptunium ATCC 15444]
    MTDQATLDAIEKAVKSNDVVLFMKGTPTFPQCGFSSTVVQILDYLGVEYVATNVLEDQNVREGIKQYANWPTIPQLYVKG
    EFVGGCDILKEMFENGELRDLMAENGIELAE

    >gi|114797424|ref|YP_760674.1| pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Hyphomonas neptunium ATCC 15444]
    MSTQYDLIVIGSGPGGYVAAIRASQLGMKTAIVERESLGGICLNWGCIPTKALLRSAEVLHLAKHAKSFGLKIEKPEFDL
    EAIVKRSRGIAAQLSGGVKFLMKKNKIDVIEGAARLEKGAPAPKVIVKGKDGKDTPYTAKHVMLATGARARDIPQAGLKA
    DGKLVWTYREAMTPDVMPKRLLVIGSGAIGIEFASFYNELGSDVTVAEVMDRILPVEDAEISGLAEKDFKKQGLNILTGA
    KVENVKPGKNTVTADITTKDGKKETKEFDRVILAVGIVGNVENLGLETLGVKVEKTHVVVDGFGRTGVPGLYAIGDLTGP
    PWLAHKASHEGVMCVEGIHGKNHAEPFDASNIPGCTYSHPQIASVGLTEAAAKEKGYDIKVGRFPFLGNGKAIALGAENG
    LVKTIFDKKTGELLGAHMIGAEVTELIQGYVIARQGELTEADLIHTVFPHPTLSETMHEAVLDAEGRVLHI

    >gi|114799698|ref|YP_760749.1| iron-sulfur cluster assembly accessory protein [Hyphomonas neptunium ATCC 15444]
    MTETIAPDVTLTASAAKRINAILAKQDGAAYLRVSVEGGGCSGFSYKFDFAPAVNADDVVIERDGASVLIDEMSLEFLQG
    SEIDFSTELIGAAFKIKNPNATAACGCGTSFSV

    >gi|114798764|ref|YP_761083.1| organic hydroperoxide resistance protein [Hyphomonas neptunium ATCC 15444]
    MFPMAINVLYKTTATATGGRDGRAKTADGALDVSLAMPKELGGSGNGNNPEQLFAAGYAACFLSAMKAVSSQGNHFKLPT
    DTTVAATVGIGPREDKGFGLVVKLDIAIPGVERAESEKLVAEAHEV
    CPYSHATKGNIEVTLNVL

    >gi|114798133|ref|YP_761121.1| putative thioredoxin [Hyphomonas neptunium ATCC 15444]
    MASEDRMIVCLACNAVNRVPEGRALTAAKCGRCAGLLATPHPAEITNDQMRALEKKDTGAFIVDLWAPWCGPCRMMAPHY
    DAAAERLQGDVRFYKINTDQHPDAAVRLNIRGVPTLVAWKGGRELTRQSGAPAGGALERWVRGLFGLAPAPN

    >gi|114799448|ref|YP_761123.1| hypothetical protein HNE_2428 [Hyphomonas neptunium ATCC 15444]
    MSDPRDLSPAMVFDALKRQDVLLIDVREPAEFANLRIHGALLHPLSTFEPRAIPANPDRRIVFQCGSGKRSRMALDRFMA
    ETGAEAAHMAGGIGAWKSAGLPCVSINPATGEVEDHGRY

    >gi|114798434|ref|YP_761180.1| selenoprotein [Hyphomonas neptunium ATCC 15444]
    MTIILDPTDERKPVSRQVTARAGSLSGTVGLLDIRKPRGNVLLDELERQLKAAAPAITVKRFAKPTFTKPCPDDLRRDIA
    GQVDYLVEALAD
    CGSCTTCSLHDTVWFEIQGIPSVSIASSEFEEAANFQRSALGMPDARYVLVPHPIQDATDDEMRAKAK
    QALSAIIDALTR

    >gi|114800123|ref|YP_761181.1| thiol-disulfide oxidoreductase domain-containing protein [Hyphomonas neptunium ATCC 15444]
    MTETKPAFSLASLSGSQHAFPTGGASLIVFVKEDCETCNTAAPVVEALHKAYGDKIQVLMPAQSGEDNAVFSARHSLTFP
    VLDDTSCQASFDWDIEIVPSVFWMDADGTVREHFEGFVRPEWEKLNADLSASLGLPVAHIDWASLPPWRPGCGSRHLYPE
    VHDKLRAAADGQSLLARRIEIAEADDVIEFMFDQGFSDGLPLVPPTPERVLKMLSGTHRAPQDVIAVVPPNMGEATTEKI
    AINAVMAGCKPEYMPVLIAALEAVCTDEFNIHGVTATTMGAAPVIVVNGPIRDRIGMNKGLGALGSGNRANATIGRALRL
    IVGNVGGGKPGGVERSTLGNPMKYTMCFAENEERSPWPPLHVERGFNKEDSVVTVFAMTGGPVHIVDQESRAPQEVAGSI
    GLGLEGVFLPKLRNMPIDALLVVCPEHIDTLMSEGPYTKAQLRARIQEVTMRPLSEMVASDTSGAGISRATAVKMGAEKL
    KTPAPKFAGKEYIHIVVAGSDAGKFSSAFHGWATGEIGSQSVSRKIDLG

    >gi|114800156|ref|YP_761184.1| pyridine nucleotide-disulphide oxidoreductase / selenide, water dikinase [Hyphomonas neptunium ATCC 15444]
    MHPDWPLSRDLVLIGGGHTHALVLRKWGMNPLPGARVTLINPGAASPYTGMLPGHIAGHYTRDELDIDLVRLARFAGARI
    VFDTACGLDLMAKRVHLTGRPPIRYDVVSIDIGATAELPGIEGFTQHAHSVKPLGLFASAWQSFLEKAAMQGRPADCAVI
    GGGVAGVELALAMAYRLKTSGLAEARITLIESGPGLLQATSAVTRRILMRALSRSGITVLTGAQVTRISSGAIALAGRES
    LPADFIVSAAGARPYPWLAETGLAHTGGFLNVGPDLRTLTDPDVFAAGDCAHLTHAPRPKAGVYAVRAAPILFENLRARL
    SGQTLREFAPQSDYLKLISKGDRSAVGHKHFFTLSGRSVWRLKDHIDKTFMARLHDLPAMRTPPPPRVRALDEEAETRSE
    PLCGG
    CGSKVGRQNLISALSGLPPALHADTITGAGDDAAVLRSGARLQVISTDHLRAFVDDPYLMARIAAVHALGDVCAM
    GAAPQSALLSLIIPRMSDPMQKATVAEVVAAVSDVLRAAGADLVGGHTSMGRELTIGLTVTGLLDGPAIGLTGARPGDAI
    LLTKPLGTGVILAAEMRGLARGKDVEHALASMQRPLAAASKILAPAAHAMTDVTGFGLAGHLMSILEASDVSARIALPDL
    PVLPGAEQLSAQGIRSSLWQSNASLEPRISRPASPISDLIYDPQTAGGLLAVVPSQSVTGLLSAFQAEGEPAFVIGRIEE
    GPPRILVN

    >gi|114798611|ref|YP_761301.1| iron-sulfur cluster assembly accessory protein [Hyphomonas neptunium ATCC 15444]
    MARRPRPKPVRLSDAAAERVKDIMAERGMGYLRVGVTNGGCAGMEYVMDYASEPAALDEVVEDNGVTILIDAKAVLFLLG
    SELDYETTLLHEKFVFRNPNQTDACGCGESVTIVPAAAE

    >gi|114797554|ref|YP_761316.1| bacterioferritin comigratory protein [Hyphomonas neptunium ATCC 15444]
    MTDRPQEGRKAPAFTLETTAGKRRLADYAGKYLVLYFYPKDDTPGCTQEALDFTAHAKDFEAAGAVVLGVSRDSLTRHEK
    FATKHNLTIQLGSDEAGKVSDAYGTWEEKSMYGRTYMGMARRTFLIGPDGKIIRVWPKVRVKGHAAEVLENINSLTE

    >gi|114799585|ref|YP_761377.1| outer membrane protein [Hyphomonas neptunium ATCC 15444]
    MLRFTPFLALGFAGLALLPACAQGGGTPDKAEIETIVREYILANPEIIEEALVALTEKERLAQASATQAAIADSKDALYN
    DSNDYFVGPEDAAVTVVEFFDYR
    CGYCKRSAEWTANLPETYDGQVRVVFKEYPIFGDISETAALAALASGRQGKYIDMHL
    ALMALKSNDELTEQKIDELAMQLGIDVQRMRADMKSDSVKNQLADMQALGRTLNVGGTPGYFVGDQAIEGANLPKIDEVI
    RAEIAG

    >gi|114799738|ref|YP_761387.1| putative lipoprotein [Hyphomonas neptunium ATCC 15444]
    MKRFPLILAAALMLSACGPAPSTESAPAAASAPAEETDTGPKAQGFITQNTAPPTGAADTKGDGVYRDSYGRPFQYALLG
    QKLPEFTAPTSDGGTFSSASINRWTVIDVWGAW
    CADCVADGPYVDALARAIAQDPDLDFVSIHVPANANRATPEELYGKY
    GSLEAYFASAGYTIPSVVLDTDASLRSLLQISWTPSYLLVSPDRVVRGFRTDLRVIEDQPVKTFIQDIAEVRKDVRDLLS
    SEPSDID

    >gi|114797286|ref|YP_761712.1| alkylhydroperoxide reductase C [Hyphomonas neptunium ATCC 15444]
    MLGIGQKLPDFQITGVKPKFMQHEQNGESAFEPLNQDSFPGLWKVIFFYPKDFTFVCPTEIAEFARLAPEFADRDAVILG
    GSTDNEFVKLAWRREHADLRELPIWQFADTNGSLVDGLGVREEGAGVAYRATYIVDPHNVIQHVYVTNLNVGRNPQDTLR
    VLDALQTDELCPCNRPVGGKTLELA

    >gi|114797596|ref|YP_761740.1| glutathione peroxidase family protein [Hyphomonas neptunium ATCC 15444]
    MRLAILALAAPFLAAACAEATAGQPTANAPAAPTEFQAEEPAPAMSATQFTSITGQPLDLTALGAKAILVVNTASRCGYT
    PQYAGLQKLYEANKADGLVIVGVPSNDFGGQEPGTEEDVKSFCEINYGVTFPLTKKYAVTGASQHPFYTGAIKTLGDPAL
    PKWNFHKILVSADGTPLKAYASSVKPDDSGLAADIEAALGI

    >gi|114797681|ref|YP_761825.1| rhodanese-like domain-containing protein [Hyphomonas neptunium ATCC 15444]
    MSAFPRTYFSRRKRLASHACLKTRKGADMRTKPAKPHLPTIAAVLLLACGFILLGLTASPEAMAQEDTQENAQENTGQID
    YAGFQALTAEAAPHRAARLVPLETFNTMRADPDTLIIDARSAQAFALGHIEGAVNLNFSDFTEEKLAAVIGPKDRRILIY
    CNNNFTDDVAPVPLKSAPLALNIATYVNLYGYGYRNLYELDGAYGLSDERVVWAGNEG

    >gi|114799507|ref|YP_761830.1| DsbD family thioredoxin [Hyphomonas neptunium ATCC 15444]
    MDERRAEAELIADRVSVAPGDTFYAALKMTMDEGWHVYWQNAGDAGLPPRLILEEGTSLPEDAVGAFLWPLPHLIPVVEG
    EIMDYGYDDEVIFAFPVTVPEDASGEVRLVAEADYLICESICIPETADVSLTLPVGAPIENAVAGAEIGKWIARVPVDFA
    GEARIDDAAEPWTLSLRQPGGFPEGAQIRFFPFKHEISHPAAQPQKAGAEGASLSLTPDRAGSIAETLDGVIRIDVPGAE
    PVGYEISASRGEAFAGTADRNVQSALPGTGAGAPDGAGDGAALGWQRIATLAFFALIGGIILNLMPCVLPVLSMKAIGMV
    QAASTGHAGELKSHGLWYTGGVLVSFLALAGALLAVRQATGSATLGFQLQHAPTVAILTLVMFAVGLWLMGYFELGSSVQ
    NLGGSLANRSGAAGAFFTGILAAVVGAPCVGPFLGAALGAVIGQPAPAVIAVFLAMGFGMALPFLILSFVPGLHRILPKP
    GKWMDTLKQAFAFPMFLTAAWLLSVVAGLAGAGAVGWTLAGATTLVFAIWLGRQGGAVRKGVAAVALGAAFIYPAVQANV
    PDTSVAGSSEAAFTGAYGEAAWSPETVEAMLADGRPVFVDFTASW
    CASCQVNKLTTLKTRKVQDAFKSANVAFLVADFTQ
    KDPMIAEELKLRARAGVPMYLWYPAGASEPQILPELLTQELVIGLVEG

    >gi|114800009|ref|YP_761844.1| glutaredoxin 3 [Hyphomonas neptunium ATCC 15444]
    MAKVTIYTRAFCPYCTRALQVLKDKGVELNEIDAGMDPALREEMVQRSNGGRTFPQIFVGETHIGGCDDMLALDRSGKLD
    PMLASV

    >gi|114797713|ref|YP_761935.1| dihydrolipoamide dehydrogenase [Hyphomonas neptunium ATCC 15444]
    MAETYDVVIIGGGPGGYNCAIRAGQLGLKVACIEMRGKLGGTCLNVGCIPSKALLHTSHLFSAAQNEFATLGIKTGKVEL
    DLAQMMGQKDEAVEGLTKGVEFLLKKNKAEYIKGKGKILGKGKVEVALADGGTRVLETKNIVIATGSEPATLPGIEIDEE
    RVVSNTGALSLKAVPKKLVLIGAGVIGLEMGSVWARLGSEVTVVEYLDRILPPADAEVAKEAERTFKKQGLAFKLGTKVT
    GIEKTKTKLKVAVEPAKGGAAETLDADIVIVAIGRKPYTEGLGLEAVGGKTDKRGVIEVTDHFKVADGVWAVGDCIPGPM
    LAHKAEDDGTAVAELIAGKAGHVNYDLVPSVVYTNPEIAWVGKNEEELKAAGVEYVKGKFPFMANSRARTNHETVGFVKI
    LAEKGTDKILGAHMIGVGVGEMIAEVCVAMEFGASSEDIARTSHAHPTLSEAVRQAAMGVEGWTMQM

    >gi|114798929|ref|YP_762008.1| ArsC family protein [Hyphomonas neptunium ATCC 15444]
    MTRTLYGLKNCDTCKKALKELEAEGKRADFVDIRAEADLPSKLPRWIAAVGEKLVNRSSTTWRGLSDADKARASGVTLEG
    LLLGNPTLIKRPVIETGDEVLVGWSAETKSRIG

    >gi|114798838|ref|YP_762058.1| ADA regulatory protein [Hyphomonas neptunium ATCC 15444]
    MQESVNTALHLAARIGWRRVTPSGKLPFMADTLFPLDDRARAYDRMAKALEWLGDSWQDWPALDEAARAMGLSPHHFQRE
    FTRWAGISPKQFQGALAHGAAGDLLRQGASVLDASLETGLSGPGRLHDLFIAHEGLTPGEAKSGGKGAELTLGKAPTPFG
    MGAWLIGPRGLIALGFIDENASPRTGFEHQGRSEDAAFANLAARYPAASLRREDAAAERMARDVFEDGQPLPVCLYGTPF
    RRQVWRALLEIPAGQTRTYGHLAAAIEAPKAARAVGAAVGANPVSWFIP
    CHRALAADGRLHNYHWGVARKRAMLVYERAH
    LA

    >gi|114797177|ref|YP_762104.1| putative molybdopterin biosynthesis protein MoeB [Hyphomonas neptunium ATCC 15444]
    MSLSPEDLDRHRRHILLKEIGGPGVAKLRAASVSIIGAGALGGPAALYLAAAGVGELELWDDDRVERSNLQRQIQFTEAD
    TGAEKGARLAARITALDPSIKVAIRHARFDESAAPSGNILIDATDNFETRFALNAFAHAHARYLVSGAASGWSGQVSVFA
    SGLVPEAPCYRCWISEMPPAAEA
    CDEVGVVGALTGMTGSAMALEAVKLITGAGDPLIGRILLIDGLRNEMRTVRLRRDSQ
    CPVCSI

    >gi|114799212|ref|YP_762138.1| putative thiol:disulfide interchange protein [Hyphomonas neptunium ATCC 15444]
    MTRYAYLGLFLIGLGAIVYVLMSAATGKPAGNPLEAFATGQMEKLDFGSAGQPIPAGTFTDTDNTSQTLEVFKGKTILVN
    YWATW
    CPPCEKEMPSLGALQTARSGDTFEVVALSVDTVEDVDYAKRRLTELGASNIPFRHAPMDAGDIIYGAGVRGFPTT
    IIYGPDGLEIARLAGEADWASAEAVQFIDAAIKAAR

    >gi|114797543|ref|YP_762150.1| methionine-S-sulfoxide reductase [Hyphomonas neptunium ATCC 15444]
    MLFMKKNLDLPTAETALKGRSIAIPTADTHFVFGRPLNAPPPEGIETAIFGLGCFWGAERIFWKTPGVWLTRVGYAGGIT
    PNPTYEEVCSGRTGHTEIVEVQFDPKEVSFAALVKLFLESHDPTQGMRQGNDIGTQYRSAIYFRSPEQEATARQMITEYE
    KALAASGHREKVTSEVKPLDTLYLAEDYHQQYLAKNPNGYCGIGGTGVSCPLPQTA

    >gi|114798714|ref|YP_762167.1| methionine-S-sulfoxide reductase [Hyphomonas neptunium ATCC 15444]
    MRTLLLAAAAACLTACSNAALPQAASAEPAARAQAAENEAIAVFAGGCFWCIEAELEEVPGVRTVVSGYTGGTTPDPTYE
    RMGDHAEAVEVIYDPAEVTYDQLLEVFWSNIDPTDEGGQFYDRGSQYRTAIYVLDDAQAAAARASLEANAKRLNQPIATA
    VIPATEFYPAEEYHQDYYLKEPDRYEAYKKGSRREETLKEVWQTE

    >gi|114799338|ref|YP_762190.1| putative thiol:disulfide interchange protein [Hyphomonas neptunium ATCC 15444]
    MKRWIYALPVLALVIVAGFGGWQMMRPSKGEFERLSRAAPEHVFPLMDGSGEISFAPPPGGQTVAVNLFASWCAPCEAEH
    KYLVALGEKHPGQVYGILYKDKVEDGAGFLERLGNPYTQVALDPEGRGGLDFGLTGVPETFVISGDGEIILHIGGPLDDA
    LAQKVSGALEAPRS

    >gi|114797794|ref|YP_762204.1| putative arsenate reductase [Hyphomonas neptunium ATCC 15444]
    MTYILIHNPGCGSSKKGLELLKANGVEPQIRKYMTAAERLSGEELKDIARKMGAKSPRAFLREKDAAAAGLSETASDAEV
    YAAMADNPKLIQRPIGINGKKAALGRPNEKLLEIM

    >gi|114797202|ref|YP_762218.1| putative thioredoxin [Hyphomonas neptunium ATCC 15444]
    MSNAALQHTKESTDQSFMADVVEASMTQPVIVDFWAPWCGPCRTLGPIIEKVVESKKGAVKLVKINTEEHQAYAGQLGVR
    SIPAVYAFDKGRPVDGFLGALPESQVRAFVDKLLSGTDDAQMIAEALSQAEAASQQGDIALATEIYSAVLQQEPENIAAI
    AGLARCHLANGDKDQAEATLALVPEAKKNDSVIKGVRLAIEMMADAPPPSELDAALTAVMASPGDHDKRFELAEQYAAAG
    KYQDAVDHLLMILSAKLDWEGGKAKDKLLKIFEAAGPTEAVTIEGRRRLSSLMFA

    >gi|114798207|ref|YP_761418.1| pyridine nucleotide-disulfide oxidoreductase [Hyphomonas neptunium ATCC 15444]
    MRHDVIVIGGSYAGMAAALQLLRARRKVLVIDAGQRRNRFAGSSHGFLGQDGADPAAIATEARKQLEAYPTLDWLEDVAL
    EAAKLEDDGGFHVRSWSGGRYQAARLIFATGVSDTLPEIEGLAERWGQHVFH
    CPYCHGYELAQGKIGVIATSPMSLHQAE
    FLTEWGDVTLFLNGVFEPDGAARARLEARRVRIEAAPIIRIEGRAEVVIEGGQRLTFAGLFTASRNAPATPIAQQLGCAL
    EETPFGTQIRRNDMKETSVPGTYACGDAAHVPHSVSLAVGDGALTGIMVHRSLLL

    >gi|114799646|ref|YP_761711.1| alkylhydroperoxidase [Hyphomonas neptunium ATCC 15444]
    MSLETLKTLIPDYAKDIRLNIGSLANETILSEQQKYGCYLASAHAVGEAQTLRAIEAEARGKLSVEALNAAKAASAIMGM
    NNVYYRATHLVSNTTYTTMPARLRMNVIGNPGVEKVDFELWSLAVSAINGCGM
    CLDAHEAELRKHGVTSEQIQAAIRIGA
    VVNAAARVLAAEAALAAEPA