Anabaena variabilis ATCC 29413 uid58043

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|75812431|ref|YP_320050.1| periplasmic binding protein [Anabaena variabilis ATCC 29413]
    MKLPGFTWRRNRYTIFFVTTLLVIIAACQMGLENPKNLPSITANFTPVTIENCGVTITYKQPPKRVVTLNQPATEIMLAL
    GLETQMVGTAYLDDRILPEYQKTYSQIPVIADKYPSKEVLLGAEPDFVYGSFPGAFGKDAVSGRKDLLSLGINSYLAEGA
    IEV
    CPNKRELLENIYNEIAEIGQIFGVSDRAVKLINNLKQELQDTQTKLGQINPPKSVFWYASESPPYTITIDSLPNKML
    SLAGGRNIFQEKANGTYITVNWEDVINHNPETIILSDASWSPAKEQRQLFLTNPAYGKISAVQKDKFIVIDYSYSTSGVR
    FAQGVKILAQALYPEKFK

    >gi|75812667|ref|YP_320284.1| hypothetical protein Ava_C0006 [Anabaena variabilis ATCC 29413]
    MKKQNIAGFSKVDDTANPQDFVSYLDAISSLNSIQKYKQQTFTRLEIQAGDRILDVGCGIGDDVRSLAVKVGNAGEVVGI
    DRSETMVKEAQSRSADLGLPVAYYVGDAEKLEFPDCTFDACRSDRTFQHLLNPRQALTEIVRVTRCGGRVVVSDPDWETL
    VIDTGDRALTRKILNFH
    CDSCVNGWIGRQLPTLFQEVGLHKINVDTYTLILTDCTLADKHLGVINAAMKAQQAGLISIAE
    AANWITNLEAASQAGRFFCAITGFLAFGCKP

    >gi|75812802|ref|YP_320419.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
    MITTATGELSLPVSDAFSFRDATANGTPEGERDHIRGPKNAPVTLVEYGDYECPYCGRAHFIVKELQQLTGDLMRFVYRH
    FPLTSVHPHAEQAAEAAEAAAAQGKFWEMHNHLFEHQQALDRKHLIEYAANLGLDVPRFSHELAEHAHAAKIREDLLSGI
    QSGVNGTPTFFINGVRHDGSYDLRSLLAAIQNAAES

    >gi|75906385|ref|YP_320681.1| thioredoxin-related [Anabaena variabilis ATCC 29413]
    MSKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALR
    LVKGEQLLDSTEGVISKDKLLSFLDTHLNNN

    >gi|75906412|ref|YP_320708.1| thioredoxin [Anabaena variabilis ATCC 29413]
    MPTDTVAYVQENEFDAVLSEDKVVVVDFTATWCGPCRLVSPLMDQLADEYKGRVKIVKVDVDNNKPLFKKFGLRSIPAVL
    IFKDGELAEKIVGVSPYEQFSAAVEKLL

    >gi|75906419|ref|YP_320715.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413]
    MPLAVGTDAPAFTVKDTNGNTVSLSDFAGKTVVLYFYPKDDTPGCTKQACSFRDAQSDYKNKDVVVLGVSADDEGSHQAF
    TQKYNLNFPLLADTNKTLISAYDVDGGGYAKRVTYVIGPDGKIVHVDASVNTTTHASDVLAALGL

    >gi|75906428|ref|YP_320724.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
    MTQATQSQQRGILLSEAALRQVKSLQEKQGQDLCLRVGVRQGGCSGMSYMMDFEQESKITPQDEVFDYDGFKIVCDRKSI
    LYLYGLMLDYSDAMIGGGFQFTNPNATQTCGCGKSFGV

    >gi|75906563|ref|YP_320859.1| thioredoxin-related [Anabaena variabilis ATCC 29413]
    MTTDSPIKPETTAGERLRNFLVAMVAIALTVALVLGLRTETAAVSLDKLYAASTPLEVAISNGKPSMVEFYANWCTVCQK
    MAPDIAEFEQQYADKVNFVMLNVDNTKWLPEMLKYRVDGIPHFVFLNKEGESLAQAIGDQPHTIMASNLEALVTGSALPH
    AQTSGQVSQVSTPVAPIGSQDDPRSHGSQVVN

    >gi|75906660|ref|YP_320956.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413]
    MSNFPQAGQPAPDFSTPDQNGNLVSLNDFHGQWVVIYFYPKDDTPGCTTEAKDFTGLHEEFHRLGAKILGVSPDSGKAHC
    KFIDKHNLSITLLSDPEHQLIEAYGAWRLKKFMGKEYMGVARSTFLISTDGIIAYTWPNVKTKGHAQAVLNKLQELTNS

    >gi|75906676|ref|YP_320972.1| nitrogenase-associated protein [Anabaena variabilis ATCC 29413]
    MARVIFYEKPGCKGGTRQKVLLTAAGHEVITYNLLTEPWTVERLRSFFGDRPVTDWFNRSAPQIKSGEIVPEQLDEQTAL
    LLMLREPLLIRRPLLQVGDRREVGFDVEILETWIGLKPVDESFRAMSENLMSQDLQGCAHGNGHSHDHHHDHQGGCNHHG
    QQEHHRQSCHH

    >gi|75906708|ref|YP_321004.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413]
    MISRRNFLHILLVSCFAVISWLNFAPTAYALGGKLPAINQPAPDFTLPTNTGDGKLSLADFRGKWVVLYFYPKDFTSGCT
    IEARRFQQDLPTYVDKNVQIIGVSADDIDSHAEFCDSEGLKFPLLADTDGAVSKAYGSWIGFVSMRHSFIIDPQGILRET
    FVKVNPSVHSTEVLARLEKLQSAAS

    >gi|75906768|ref|YP_321064.1| hypothetical protein Ava_0545 [Anabaena variabilis ATCC 29413]
    MRANKFSTHHSFKLDWANKATTTICIMTNRLAQTKSLYLRKHAENPIDWWPWCDEALATAKSQDKPIFLSIGYSSCHWCT
    VMEGEAFSDQAIAEYMNANFLPIKVDREERPDIDSIYMQALQMMSGQGGWPLNVFLSPEDLVPFYAGTYFPLEPKYNRPG
    FLQVLEALRRYYDTEKEDLRQRKALIVESLLTSAVLKGEATQEAEESELLRSGWETNTGVITRNEYGNSFPMIPYAELAL
    RGTRFNFASRYEGEQISTQRGLDLALGGIYDHVAGGFHRYTVDPTWTVPHFEKMLYDNGQIVEYLANLWSAGVQEPSFAR
    AVTGTVAWLQREMTAPAGYFYAAQDADSFTTPTDTEPEEGAFYVWSYAELEQLLTPTELTELQQQFTVSPQGNFEGKNVL
    QRRHQWELSATIETALGKLFVARYGSAADTLETFPPAQDNQEAKTTHWPGRIPSVTDTKMIVAWNSLMISGLARAAAVFQ
    QPLAGELAAKAANFILENQFVDGRFYRLNYRGEAAVLAQSEDYALFIKALLDLHAATPENRFWLEKAIALQQQFDEFLWS
    IELGGYFNTASDASQDLIIRERSYMDNATPSANGVAIANLVRLSLLTDDLHYLDLAEAGLKAFKTVMSSAPQACPSLFTA
    LDWYRNSTLIRSTIEQINSLTPQYLPTVAFSVVSSLPDNSVGLVCQGLKCLPSANSVEQLLQQVQQSQNRG

    >gi|75906814|ref|YP_321110.1| glutaredoxin-like protein [Anabaena variabilis ATCC 29413]
    MTQETSEKISNLITQNKIMVFMKGTKLMPQCGFSNNVVQILNTLGVPFETINVLEDQEIRQGIKEYSNWPTIPQVYINGE
    FIGGSDILIELYQKGELQQLVEVALAS

    >gi|75906850|ref|YP_321146.1| hypothetical protein Ava_0627 [Anabaena variabilis ATCC 29413]
    MTILETSNTPVGGYAPDFELPGIDNHVHHLSRYLDNFRAVGVVSLGNHCPYVNLYLDRLKAIQGEFGAEGFILIGINASD
    ITEPSWSSLEKMKAFAQNHKLNFPYLWDSTQEVSRSFGATKTPIAFLIDSHGILRYRGQIDNHPQEPSSVGEDYLRNAIA
    ALFKGEEIPVPETEPVGTSLIWHI

    >gi|75907217|ref|YP_321513.1| hypothetical protein Ava_0994 [Anabaena variabilis ATCC 29413]
    MLNPNLEDIQLTKDDYERYSRHLILPEVGVEGQKRLKAASVLCIGTGGLGSPLLLYLAAAGIGRIGIVDFDVVDTSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETRLSSENALDIIRPYDIVVDGTDNFPTRYLVNDACVLLNKPNVYGS
    IFRFEGQATVFNYEGGPNYRDLYPEPPPPGLVPS
    CAEGGVLGILPGIIGVIQATETVKIILGNGNTLSGRLLLYNALDMK
    FRELKLRPNPIRPVIEKLIDYEQFCGIPQAKAAEAQKMQEIQEMTVTQLKELLDSGAKDFVLLDVRNPNEYEIAKIPGSV
    LIPLPDIENGNGVAKVKEALNGHRLIAH
    CKMGGRSAKALAILKESGIVGTNVKGGITAWSREVDPSVPEY

    >gi|75907348|ref|YP_321644.1| Cd/Co/Hg/Pb/Zn-translocating P-type ATPase [Anabaena variabilis ATCC 29413]
    MTQTPELKTEILQVSGMDCGSCAKTIEVGLQQLSGVTEASVSFATGKVRVSYNQEHLSQKTICDRIQALGYTVEQSSQVE
    SEQKTHTCDHDHDHHNHHHSLAHDHQLVQVAEAKIPGMNCGTDSTNWKFWLTNRRGQSVILTGIGLGLGLLAQYLGLPIW
    IARAFYSVGIVIAGYPIAKAGLFELRLRRADMNLLMTISVIGAVILGDWFEAALVLFLFSFGTTLQIFTFGRTRHAISAL
    MDLTPPTATVRRGNQEVTVPVESVQVGEILTIRPGGRIALDGVVVSGASTIDQSSITGESIPEDKQKGDTVFAGTVNQSG
    FLEVKVTHTANDTTVAKIIHLVEQAQESRAPSQQWVDRFAERYTPIVIFMAIAIAVIPPLAFAQPGDVWFYRALVMLVIA
    CPCALVISTPVSIVSAIGAATRQGVLFKGGNALETAGRLTTLAFDKTGTITQGLPVVQQIYNFGAANANMVLQIAASLEQ
    HSEHPLAKAIVTKADELGMELAIPIKFTALPGKGIQANLGKILYLVGNRRLFSEQDIPLSGEAESLLTKIEQQGQIPVLV
    GTKQELLGAIALSDGIRLEATEALRQLKRMGLNRLVMLSGDRTPVAQQIAQQVGITEYRAELLPQDKLQEIQQLRQTGVV
    GMVGDGINDTPALAAADISFAVGGIDIALETADVVIVGSDLRRLAYAVDLSRRTVSVIQQNVIFSLVTKALFLLLGTFGF
    VGLAVAVLADTGTSLLVTANGMRLFTTKKII

    >gi|75907403|ref|YP_321699.1| methionine sulfoxide reductase A [Anabaena variabilis ATCC 29413]
    MALFGFGKKLALPTPEKALPGRAQIMPVPANHYVNKNPLKPPFPEGFEKALFGLGCFWGAERKFWQQSGVYTTAVGYAAG
    FTPNPTYDEVCTGLTGHNEVVLVVFDPKVISYTQLLKVFWESHNPTQGMRQGNDVGTQYRSGIYVYSEAQKQLAEASRDA
    YQQALSSAGYEKITTEILDAPEFYYAEAYHQQYLAKNPNGYCGLGGTNVACPVGVFESSANG

    >gi|75907514|ref|YP_321810.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
    MIHLSQAAASEINRLKAKQHSMSLFRLTVKPGGCSDWFYEMSFDEKIKEGDRIFDINNTQVVIDHASYNYINGLAIDYSE
    DLMGGAFRFQNPQAIVTCGCGNSFSTATPSSV

    >gi|75907581|ref|YP_321877.1| 1-Cys peroxiredoxin [Anabaena variabilis ATCC 29413]
    MALRLGDTVPNFTQASTHGDIDFYEWAGDSWVVLFSHPADYTPVCTTELGTVAKLKPEFDKRNVKAIALSVDDVESHKGW
    VGDIEETQSTTLNYPILADADRKVSDLYDMIHPNANAAVTVRSVFVIDPNKKLRLSFTYPPSTGRNFDELLRVIDSLQLT
    DNYSVATPADWKDGDKVVIVPSLKDPEVLKEKFPKGYEVVKPYLRLTPQPNK

    >gi|75907770|ref|YP_322066.1| copper-translocating P-type ATPase [Anabaena variabilis ATCC 29413]
    MQLVPQTQLDPELTPTLEKIILDVGGMKCAGCVKAVERQLTQYSGVKNACVNLATEVAVVESEVGTVDPEMLAQRLTSAG
    FPTQPRTASSKASESTIEDSAARQRQQMQTAFQQLIIAAVLLVFSGIGHLGNIGSSILPILNNIWFHFGLATVALLIPGR
    PILVDGWLGWRRNAPNMNTLVGLGTLTAYTASVVALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGKAAAAFRQLLA
    LQPQIARLIANPDPENIGLGANTVEIPAEQVKVGEWLQVLPGDKIPVDGEVRFGQTTLDESMLTGEAVPVMKQPGDIVTA
    GTINQSGAIAIQATRTGNDTTLAHIVALVEAAQTRKAPIQKLADTVAGYFTYGILTASVLTFIFWYCFGTHIWPDITVSG
    GGMEMMMNHAAHITNNSPLLISLKLAIAVMVVACPCALGLATPTAILVGTGIGAERGLLIKGGDVLEKAHQLDTVVFDKT
    GTLTTGNPVVTDCLVFAEDTPNEISFTSLHLHTPTPLHPSHSLIQLAAAVESGTHHPLARAIQQAAQQQQLSIPEATDFH
    TEPGMGVSAVVDGQTVLLGNGDWLSWHGITWSETAQQEAQKLATEGKTVVGVAVGESLAGLIGVQDTTRPDAQTTVDKLR
    QMGLRVMLLSGDRPEAANAIAQQLGIDRADVMAGIPPAKKATFIQELQTKSGAKVAMVGDGINDAPALSQADVGIALHSG
    TDVAMETAQIVLMRDRISDVVESIHLSRATFNKIRQNLFWAFAYNTIGIPLAAGVLLPNWGFVLSPSGAAALMAFSSVSV
    VTNSLLLRRLAHR

    >gi|75907884|ref|YP_322180.1| rhodanese-like protein [Anabaena variabilis ATCC 29413]
    MTGNTSGQPMTQISVNELAVYLANEDANIQLIDVREPQELAIAQIHGFVNLPLSEYAQWSEKVPTMFNPEAETLVLCHHG
    VRSAQMCQWLVSQGFTNVKNIAGGIAAYSLLVDSSIPQY

    >gi|75907968|ref|YP_322264.1| thioredoxin-related [Anabaena variabilis ATCC 29413]
    MVLSVSERTFTQEVLESPVPVLVNFEAPWCGLCRIIHPLLLQFQSQCGEQIKLVGVNADENFKLSNTYRLKSLPTLLLIE
    NGIIRHRLEGFRGRDDLRLALEEIRLSYTNRPKAYSSSKTADLECRTA

    >gi|75907986|ref|YP_322282.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anabaena variabilis ATCC 29413]
    MTIDYDVVIIGGSLTGRYAALTATQMGAKVALVESQQNNSLIIHQAIGEIANLTQNLHNLASCGIDAVHVDTSEKCQISL
    ALSSAQGIAANVQEQMSLAHLSAQGVDVIVDSGQFQSSPHLAFAVTHRLLRGRTYLLASGSLPAIPKIEGLQTTDYLTPA
    NIWQYLYKQHSQFSELPHNWVIIGGTPQSIEISQTLARLGCNITLVVKSPHLLPQLDPEIAQFLQAQLEVDGVRVLTQKM
    VTQVKRIDNKKWVQAGEKAIETDEILIAIGHKPNIESFNLPEVGVKWHQHRLLVNDKLQTTNHRIYACGDVIGGYDFPNI
    ANHEARIALNNALFFPRWQVNYQNIPWAILSYPVLAQVGLTDIQAKHQFSQQEVIVLRHYYKSIAAAQLRNEITGICKLV
    VLRNGKILGATIFGTEARELINLIALAMSQNIPVKHLGNLSVVYPSFSEILEQTARNFSQQRFNSNTVWQDWLEGFFYLR
    RNWNL

    >gi|75908000|ref|YP_322296.1| rhodanese-like protein [Anabaena variabilis ATCC 29413]
    MTDTQFVVSSSWLLQNLHNIDVVIVDCRFSLADPQLGKQQYQTSHIEGAYYLDLNLDLSSPVGEHGGRHPLPNPDELAQK
    LASMGIEFQKTLVVAYDDSRFAFASRLWWLLRYLGHEQVAVLNGGFSQWEQAGYPITDVIPQVKTANFVPQIQTQLLVDI
    NIVKTRKDLPQVVLVDSRESDRYRGEREPIDKIAGHIPGAVNYPWMEVTDSSGYSIPLTEHQQRWQNLATAEEILVY
    CGS
    GVTACVNLLSLEVAGIHTGKLYAGSWSDWISY

    >gi|75908013|ref|YP_322309.1| rhodanese-like protein [Anabaena variabilis ATCC 29413]
    MTNTKNLTEIDAITLKQWIEENTVLLIDVREAAEYAAEHIPDAKLLPLSNFTADQVTPQCENIVLYCRSGNRSHQAVQKL
    IDAGVSNVYQLQGGLPTWKAAGLPTKVNLSAPISLMRQVQIVAGSLVFLGTVLGAFVSPWFLILSGFVGGGLVFAGVTNT
    CAMGNLLAKLPYNRRMA

    >gi|75908017|ref|YP_322313.1| methionine sulfoxide reductase B [Anabaena variabilis ATCC 29413]
    MKKRYFLQTSAALVGTALLPPYIFQRSSIMAASNTKFEIAKSEQEWQTILTPEQFRVLRKHGTERAFTSSLDKEYSEGTY
    VCAGCGQPLFTSDTKFNSGTGWPSFFTPIEGAIGTTTDRSFFMTRVEVHCSRCGGHLGHVFDDGPAPTGKRY
    CMNGVSLK
    FEPA

    >gi|75908056|ref|YP_322352.1| glutaredoxin GrxC [Anabaena variabilis ATCC 29413]
    MAATVEIYTWRTCPFCIRAKNLLNNKGVEFVEYSIDGDEEARDKMAQRANGRRSLPQIFINDRHVGGCDDIHALERQGQL
    DELLAI

    >gi|75908148|ref|YP_322444.1| dihydrolipoamide dehydrogenase [Anabaena variabilis ATCC 29413]
    MSHEFDYDLVIIGAGVGGHGAALHAVSCGLKTAIIEAGDMGGTCVNRGCIPSKALLAASGRVRELRDAHHLKSLGIQIGN
    VEFDRQAIANHANNLVSKIQGDLTNSLKRLGVDIIRGWGKIAGTQKVTVTGDGGEKTITARDIILSPGSVPFVPPGIEVD
    GKTVFTSDQGVKLETLPEWVAIIGSGYIGLEFSDIYSALGCEITLIEALDQLMPGFDRDIAKLAERVLITPRDIETKVGV
    YAKKVIPGSPVVIELADFKTKEVVDVIEVDACLVATGRIPATKNLGLESIGVELDRRNFIPVDDRMAVLSAGEVVPHLWA
    IGDANGKMMLAHAASAQGIVAVENIIGKERTVDYRSIPAAAFTHPEVSYVGLTETGAKELGQAEGFEIATSRSYFKGNSK
    ALAENEADGIAKVIYRKDTGEVLGVHIFGLHASDLIHEASAAVANRQTVQTLAHLVHAHPTLSEVLDEAYKRAIV

    >gi|75908244|ref|YP_322540.1| putative thiol-specific antioxidant protein [Anabaena variabilis ATCC 29413]
    MLTSTDFSGLLNERFFRNFLPIPASNELRLDVGTPDFQLPDITNGTLVKLSNYRGKQPVLLAFTRIFTEKQYCPFCFPHI
    KALNENYEQFTNRGIEVLLVTSTDEKQSQIVVKDLSLKMPLLSDPSCRTFRTYQVGQALGAPLPAQFVLDKDGRLRYKHL
    FSFFDHNASIEKLLEKFD

    >gi|75908245|ref|YP_322541.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413]
    MSITYGTQESLRVGQQAPDFTATAVVDQEFKTIKLSDYRGKYVVLFFYPLDFTFVCPTEITAFSDRYEEFKKLNTEILGV
    SVDSEFSHLAWIQTDRKSGGVGDLNYPLVSDIKKEVSDAYNVLDPAAGIALRGLFIIDKDGIIQHATINNLAFGRSVDET
    LRTLQAIQYVQSHPDEVCPAGWQPGEKTMTPDPVKSKVYFAAV

    >gi|75908362|ref|YP_322658.1| glutaredoxin GrxC [Anabaena variabilis ATCC 29413]
    MLNLFNQFFGRSPEKIKANVEIYTWQTCPYCIRAKLLLWWKGVQFTEYKIDGDEAARANMAERANGRRTVPQIFINNQHI
    GGCDDLYELDTKGQLDPLLVQPA

    >gi|75908461|ref|YP_322757.1| glutathione reductase [Anabaena variabilis ATCC 29413]
    MTFDYDLFVIGAGSGGLAASKRAASYGAKVAIAENDLVGGTCVIRGCVPKKLMVYGSHFPALFEDAAGYGWQVGKAELNW
    EHFITSIDKEVRRLSQLHISFLEKAGVELISGRATLVDTHTVEVGDRKYTADKILIAVGGRPLKPELPGMEYGITSNEIF
    HLKTQPKHIAIIGSGYIGTEFAGIMRGLGSEVTQITRGDKILKGFDEDIRTEIQDGMTNHGIRIIPNTVVTAVEQVPDGL
    KINLSGDQEPIIADVFLVATGRVPNVDGLGLENAGVDVVASSVEGPGYSTMNAIAVNEYSQTSQPNIYAVGDVTDRLNLT
    PVAIGEGRAFADSEFGNNRREFSHETVPTAVFSNPQASTVGLTETQAREKLGDEGVTIYRTRFRPMYHSFTGKQERIMMK
    LVVDTNTDKVLGAHMVGENAAEIIQGVAIAVKMGATKKDFDATVGIHPSAAEEFVTMR

    >gi|75908495|ref|YP_322791.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Anabaena variabilis ATCC 29413]
    MKLLIDKISSEIGTILIVSDRKRLCALDFADYEARMLKLLQKRYGSCDFQEVENPQGFSSLIQAYLQGDRYSLKNLPIET
    GGTPFQQQVWLALQTIPWGTTISYGELAAKINKPTAYRAVGLANSLNPIAIVIP
    CHRVIGANNLLTGYAGGLERKRWLLD
    HEGIVIHP

    >gi|75908647|ref|YP_322943.1| mercuric reductase [Anabaena variabilis ATCC 29413]
    MSNSELDRVIVRPVDEYNQKLVAYVHPPNWVNPQPADSYDLVVIGAGTAGLVVAAGAAGLGLGLKVALIEKHLMGGDCLN
    VGCVPSKTIIRSSRVVGEIWNGKNLGINIPSQIDIDFPAVMARMRRIRADISHHDSAERFASLGVDVFLGSGKFASSDIV
    EVAGKTLKFKKAVIATGARATKPAIIGIEQAGYLTNETVFSLIQRPEKLAVIGGGPIGCELAQAFRRLGSEVVLIHSGSH
    LLNKEDNDAAQVVQQTLIKEGIRLVLNAKVEEVVTVTEGKRLYFSTNGYRDSVTVDEILVGAGRSPNVEGLNLEAVGVKY
    DKRRGVEVNDYLQTTNPKIYAAGDICMDWKFTHAADAAARIVIKNTLFSPFGLGRSKLSSLVMPWVTYTDPEIAHVGLYE
    SQDVETIKIPFSSVDRAIADAQEDGFLKIHHKKGSDEIVGATIVATHAGEMISEITTAIVNKIGLNKLSNVIHPYPTQAE
    AIKKAADTYRRTLLTPRTKKLLGFLTKFS

    >gi|75908820|ref|YP_323116.1| alkylhydroperoxidase AhpD core [Anabaena variabilis ATCC 29413]
    MTKLIEYEDAGDEVKAIYDDIRATRQTEYINNFWKAIANHPPTLKRTWESIKEVMASPGELDPLVRELIYIAVSVTNGCD
    Y
    CISSHSAAARGKGMNDAMFGELLAIIATANTTNRLANGYQIPVDEIFKT

    >gi|75908866|ref|YP_323162.1| thioredoxin [Anabaena variabilis ATCC 29413]
    MSAAAQVTDSTFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEIAQQYEGKIKVVKVNTDENPQVASQYGIRSIPTLMI
    FKGGQKVDMVVGAVPKTTLSQTLEKHL

    >gi|75908899|ref|YP_323195.1| hypothetical protein Ava_2687 [Anabaena variabilis ATCC 29413]
    MSIQVYGIPNCGTCKKAFNWLQAHKVDYEFINTKENPPTRENIQNWVKSLGSTPMRNTSGQSYRALGEEKKNWTDEQWIE
    EFAKDAMLLKRPLFVKDGIAVAVGFRDEKVIQEKLGF

    >gi|75909125|ref|YP_323421.1| hypothetical protein Ava_2915 [Anabaena variabilis ATCC 29413]
    MALTASIMVPIGTQAPDFHLPDVVSGKTISLSTFADKKALLVMFICRHCPFVKHIQDELTRIGQDYATRDLGIVAISAND
    AENYPDDAPESLKALAIELGWQFPFCYDETQETAKAYTAACTPDFFVFDDHRHLAYRGQLDDSRPSNGKPVTGADLRAAI
    DAVLAGKPVIDEQKPSVGCNIKWKSTP

    >gi|75909155|ref|YP_323451.1| putative iron transport system substrate-binding protein [Anabaena variabilis ATCC 29413]
    MENSSVRIVSLIPSATEILANLGLSDAIVGRSHECDYPPEIQNRPTCTQARLNSDASSSEIHHEVNNVLQSALSIYQVKL
    DVLEQLKPTHILTQDQCDV
    CAVSLKDVEEAVKELTQSSPQIISLQPNLLEDVWQDIERVAHIFGVDSVKILDNLEARVKI
    CQQKIQGLSLEEVPTVACIEWTDPLMAAANWIPELVNLAGGQTLFSLIGQPSPHLEWENLLISNPDIIIFMPCGFNLQRT
    RQEAQLFTQNPEWTKLHASQTGRVYITDGNSYFNRPGPRLVDSLEILSEILHPEIFDYGYKGTAWEPL

    >gi|75909255|ref|YP_323551.1| ferredoxin (flavodoxin) oxidoreductase [Anabaena variabilis ATCC 29413]
    MKNRTFATIDGNEAVAQVVYQINEVIAIYPITPSSPMAEWSDAWASEGKPNIWGTVPTVVQMQSEGGVAGAVHGALQTGS
    LTTTFTASQGLLLMIPNMYKIAGELTPTVFHIAARSLAAQALSIFGDHSDVMATRGTGFAMLCAASVQEAHDFALISTRI
    TLESRIPFLHFFDGFRTSHEINKIELLTTEDFKGFIPNELVIAHRSRALTPDKPVLRGTAQNPDVYFQARETVNPYYLAC
    PEITQKVMDEFAQMTGRQYQLFEYHGDPTAERVIILMGSGCETVHETVDYLNALGEKVGVIKVRLYQPFDSQRFIAALPT
    TTRGIAVLDRTKEPGASGEPLYLDVVTALYEKWGVGSLPTVIGGRYGLSSKEFTPGMVKAVFDNLAATIPKNHFTIGIND
    DVSHTSLDYDPDFNIEPDNIVRAIFYGLGADGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGSQLIRS
    TYLINKASFVACHQWDFLEKFPILKDIVQGGTFLLNSPYDQDEVWERLPGKIQAQIQQKQLKVYVINAYKVAREAGMAGR
    INTVMQVCFFALSNVLPREEAIAEIKKYIRKTYGKKGDQIVQMNIKAVDTTLDNLHELVTREYSAPPQIPNHHYPLSPEG
    APPSSIPYILGKMIAREGDELPVSALPNDGTYPTGTAKWEKRNIAQEIPVWDTDV
    CIQCGKCVMVCPHSVIRSKVYEPEQ
    LENAPSTFKSANAKDHDWHGLKFTIQVAAEDCTGCGICVDVCPAKNKAQPRKKAINMEPQLPLRQAERENWDFFLSIPNP
    DRRELKLTHINQQQMQEPLFEFSGACAGCGETPYIKLGTQLFGDRMIVANATGCSSIYGGNLPTTPWTQNAAGRGPAWSN
    SLFEDNAEFGLGFRVSIDKQTEIASQLLQELATVVGRELVDDILNNQQNNEAEIWEQRDRISILKQKLQALVNPELTSKA
    QLLLSLADYLVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVLDTEVYSNTGGQMSKATPKGAVAKFASGGKPAAK
    KDLGLMAMTYGNVYVASVAMGAKDEHTLKAFLEAEAYSGTSLIIAYSHCIAHGINLSTAMQNQKAAVDSGRWLLYRYHPD
    LVKQGKNPLQLDSRTPKLPLEESMYLENRFKMLTKINPEVAKELLKEAQTDVNLRWQMYQYLAAREVTQG

    >gi|75909582|ref|YP_323878.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anabaena variabilis ATCC 29413]
    MQISKINISERLDHVYDAIIVGGGAGGLSAGIYLQRYRLSSLIIDKGKARSFWMQELHNYLGLPPDTPGRVLLQQGKKHY
    ESLAGDFLTAYVEEVVDEGDTFAVRVKVGRQNSTYFVLHSKYLIAASGIIDHLPSLENMQNVFEYAGYNLHV
    CMVCDGYE
    MIDKQCGFFAGSEASIEEMVFNLSWFTPYITIFTHGLFTVSTELRSKLQQYGYRLVETPIKRFLGQNHHMSGVELVDGTV
    VELETGLISMGSRYHNTYLQRIDLELKGGNLVTDKMCRTSHPRIFAIGDLKVGLNQVVIAAGDGALAATQIWRDIRRSFG
    VRCWQENLISNI

    >gi|75909666|ref|YP_323962.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anabaena variabilis ATCC 29413]
    METADVIVIGSGQGGIPLAADFANEGRKVVLFERDALGGSCINYGCTPSKAFLAAAHTAGRANQGKKLGIHTEVEVDFPA
    VMERVREIRSSFNQGIRQRLESAGVKVICAEASFVGERTVKGGDVTLQAPLVIINTGTSSLIPDIPGLAGTPYLTNRNFF
    DLNTLPARLLVIGGGYIGLELGQGLARLGSQTHLIVRGDRVLGQEEADVSEVLAEALKQDGIGLHFGVNVNHVAHENNVF
    KLTLSSGEQLQGEALLVVIGRKPNTGALNAANSGIELDDKGFVKIDDQFHTTCSGVYAIGDAAKQPAFTHVSWEDYRRLK
    AILCGENRTRSDRVLGYAVYTEPQVGRVGMTLEQAQKQGINACAVTLPMSQIARAIEWGHDLGFYRMVIDSDTDKILGAT
    LVGYETAELVHVFLSLIEAGATWQLLERSVHIHPTYGEALPSLARLLLGDNMPGCPNM

    >gi|75909779|ref|YP_324075.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Anabaena variabilis ATCC 29413]
    MNSPIYQTVIVGGGFTGLFTALHLAHEHYPRSVILIDRNERFCFKPLLYEYFDNEMDSFQVVPRFSELLKGSGVIFVQDT
    VQTIDLHQREVKLASGNSYSYSNLVLALGSVTGYHHIEGANINAFPFWTQADAIALDRHLRDCLQKAIQTEDIKQRRQLL
    TVVVVGGGASGVEMAATLADFLPHWYAALGGNSEEIRVILLNHGQKILDGDINDPLRPIAEKELQKRSVAIEIITEAEAT
    AVHPNAVEYKSHGEIKTLTTHTTIWTAGTSIHPLIQELPIPQEHRDHHSRPLVTSTMQFLDFPEVFAGGDCAAVQDSFLP
    PTAQVAYQQGANIAHNLKALALGEELEPAKVNIRGTLLKLGLNDAAANLFNVFEVVGEPAHLIRQGTYLTLLPTPIHDFQ
    ATTEWVDEEIFHHHLDPHDVGKKVVQAVEVVGAGIVSVLVGRKLLKMLGDDEKVK

    >gi|75909875|ref|YP_324171.1| NHL repeat-containing protein [Anabaena variabilis ATCC 29413]
    MIPRVRAPELPQNYPWLNTEQPLSIKQLRGRVVILDFWTYCCINCLHVLPDLKYLEQKYKDSLTVIGVHSAKFDNEQETE
    NIRQAILRYDIEHPVLVDKGFRVWQEYAVRAWPTLMVIDPKGYVIGYVSGEGNRDKLDQLITQVIQEHQGAINFQQLSLT
    LEKQRQPLITPLAFPGKVLATPGGLFVADSGHHRIVVSDFNGEILHLIGNGKSGLTDGNFQEAQFSAPQGMAFDMENQIL
    YVADTDNHVVRRADIQQQTVETIAGTGEQSRNIQPHGGAGLETALNSPWDLVKVGNSLYIAMAGTHQIWQMDLPSGFVKT
    YAGTGAEGCFDGYLTESVFAQPSGITNNEQELYIADSEISSIRGVGLLEPQEVRTVCGSGGLFGFGDVDGQGENVRLQHC
    LGVEYFQNYLWVADTYNHKIKLVSPHTGNCQTVLGDGSAGLQNGQGKNTRFFEPSGLSAMDSYLYISDTNNHVIRRVDLR
    TLEVTTMQFNGLCAPDVCIPNNF

    >gi|75909967|ref|YP_324263.1| thioredoxin [Anabaena variabilis ATCC 29413]
    MTEKKQFNSFEEMLSGSDLPVLVDFYADWCGPCQMMATILQQVNNQLKDRIRIVKIDTEKYTELATQYQIYALPTLVLFK
    QGKPVDRIEGVLQTPDLVQRLQSFV

    >gi|75909986|ref|YP_324282.1| methionine sulfoxide reductase A [Anabaena variabilis ATCC 29413]
    MKMELKSGSTETPMEKATFGAGCFWGVEAAFRQVKGVVSTSVGYMGGHFPNPCYLDVLSRITGHAEVVQIEYDPQLVSYE
    DLLAVFWDIHDPTTLNRQGPDKGEQYRSVIFFHNEQQAEAARQSKAKLQVSGRFERDIVTEIKHKSEYYLATEEHQQYFE
    KQAKR

    >gi|75910001|ref|YP_324297.1| hypothetical protein Ava_3797 [Anabaena variabilis ATCC 29413]
    MIGLNCKPLYIENAENQLYNPTLNIKTTMTYLETAAQFYSEVAQTPQVGLCCVQSTPLQLPGLKIPLSMQEMNYGCGTTV
    HPTELGKQPTVLYVGVGGGLEALQFAYFSRRPGAVIAVDPVAAMREAAARNLEMALTDNPWFESSFVEIREGDAFNLPVA
    DGSVDIVAQNCLFNIFEPEDLTRALKEAYRVLKCGGRLQMSDPIATSPIPAHLQQDERLRAM
    CLSGALTYEEYTQRIIDA
    GFGQIEIRARRPYRLLDSQTYNLETHLLLESLDSVSFKVPIPEDGACIFTGKTAIYAGCEDFFDDKAGHILQRGIPATV
    C
    DKTAAKLATVKPKEVIITDSTWHYNGGGCC

    >gi|75910085|ref|YP_324381.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Anabaena variabilis ATCC 29413]
    MPVKVGDSAPDFTLPAQNGSSVSLSDFRGKKAVVLYFYPKDDTPGCTAESCAFRDRYEVFQTAGAEIIGVSGDSNESHQK
    FASKYNLPFTLLSDKGDQVRKLYGATAAFGLFPGRVTYVIDQQGVIKYVFDSMFNFQGHVEEALKTLQQLANK

    >gi|75910142|ref|YP_324438.1| MoeZ/MoeB [Anabaena variabilis ATCC 29413]
    MINLTPTELERYSRQMMLPNFGEAAQKRLKSATVLVTGVGGLGGTAALYLAVAGVGRLILVRGGDLRLDDMNRQVLMTDD
    WVGKPRVFKAKETLQAINPDIQIETIHDYVTSDNVDSLVQSADMALDCAHNFTERDLLNSACVRWRKPMVEAAMDGMEAY
    LTTIIPGVTPCLS
    CIFPEKPEWDRRGFSVLGAVSGTLACLTALEAIKLITGFSQPLLSQLLTIDLNRMEFAKRRLYRDRS
    CPVCGNDAPWRYAQSNSMETSSNCTHS

    >gi|75910143|ref|YP_324439.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
    MTVTLTEKAEFRLRAFLRGSAKDANETTKGIRISVKDGGCSGYEYLMDVTSQPQPDDLVSQQGSVLVYVDAKSAPLLEGI
    VIDFVEGLVESGFKFTNPNATSTCGCGKSFKAGDCSPEGVPCS

    >gi|75910281|ref|YP_324577.1| YeeE/YedE [Anabaena variabilis ATCC 29413]
    MSNGVENTLTSKSQLLPPRPQKLVVAIALFIFTVGSVLLSKYGWRQSVLFLIGGLLGVSLYNSSFGFASAYRKLLLNRDV
    RGIYAQLVMLAIATVLFAPVLAAGKAFGQEVAGAIAPVSISGAIGAFIFGIGMQLGGACGCGTLYTIGGGSYTMLITLIT
    FCLGAFWASLTRYLWAGLPKAEPIVLGETLGWTGAVVLQLGILLLLAGGLWLWSKNSKSASAEHPSPTRSGFLFGSWSVF
    TGAIALAVLNWLTLLISGEPWRITWGFALWTAKIATMFGWNSSTSKFWDGDTALSNSVFADVTSVMNLGIILGALLAAAL
    AGKLTPQTQVSPSKILATVIGGLIMGYGAFTAFG
    CNVSAFFSGIASTSIHGWVWIVCALLGTAIGIKLRPLFSLPN

    >gi|75910282|ref|YP_324578.1| rhodanese-like protein [Anabaena variabilis ATCC 29413]
    MMKIRKFSWAKFKKNKLLALGVAICTFLLLTPMLHLPARGAATSTKIQFVAPNWVAENVKDPNLRILDVRNLPLDYIDGH
    LPQAVNIADTAFRGPREGLPVQYWDNQKLGQIFANSGVTNNNRVLVYSDGRDVLGATMVAYLLERSGVQDIAVLDGGYKG
    YAAASATVTKEFPKYKVGRFIVKDNPAVRVSLSEVRKLIGKKGVTFIDPRPADLFQGKENLWVRNGHIPGARNIPWPTFT
    DAQNPHKLKSLDEIKQILADKKITPADDIIVT
    CSTGREATLQYVVLKHLLGYPKVRVYEGSWTEYSTQSDLPVATGPEQV
    S

    >gi|75910433|ref|YP_324729.1| copper-translocating P-type ATPase [Anabaena variabilis ATCC 29413]
    MKNVTLKLRGMSCASCAKSIADTINSVPGVHDCSVNFGTEQATVNYDPRKTDLQAIQNAVNAAGYSASPLQEQNLMAGDD
    DEEKRYRLQESRDLRRKVTVGGIISIVLVIGSLPMMTGLHLPSIPTWLHNPWLQLILTTPVQFWCGYSFYINSWKAFQRH
    AATMDTLIVLGTSAAYFYSLFATLFPGFFIAQGLMPDVYYETAAIVITLILLGRLFENRAKGQTSEAIRKLIGLQAKTAR
    LIRNGREVDVPIEEVEIGDIVLVRPGEKIPVDGEVIDGTSTIDEAMVTGESIPVQKQPGDEVIGATINKTGSFQFRATRV
    GKDTVLAQIVQLVQQAQGSKAPIQRLADQVTGWFVPAVIAIAILTFIIWYNFMGNITLALMTTVGVLIIACPCALGLATP
    TSVMVGTGKGAENGILIKGAESLELAHQIHTIVLDKTGTITQGKPTVTDFVAVNGTVNSNEIKLIQLAASLERNSEHPLA
    EAVVRYAQSQEVTLANVTDFAAVVGSGVQGIVAHHLVQIGTQRWMEELSINTQALQPDKERLEYLGKTAVWLAVDGEIAG
    LMGIADAIKPTSTQAIRALQKLGLEVVMLTGDNRRTAASIAREVGIKRVLAEVRPDQKAATVQAIQAEGKIVAMVGDGIN
    DAPALAQADVGIAIGTGTDVAIAASDITLISGDLQAIVTAIQLSRATIYNIRQNLFFAFIYNVAGIPIAAGILFPIFGWL
    LNPIIAGAAMAFSSVSVVTNALRLRKFQPKTPA

    >gi|75910454|ref|YP_324750.1| MoeZ/MoeB [Anabaena variabilis ATCC 29413]
    MVNLTSTELERYRRQIILPGFGQEAQQRLKSATVLVTGVGGLGGTAALYLAIAGVGRLILVRGGELRLDDMNRQILMSDD
    WVGKPRVFKAKKRLEDINPDVEVEAIFDYVTPDNVDSLIQSADVALDCAHNFGERDLLNAACVRWRKPMVEAAMDGMDAY
    LTTIIPGVTPCLS
    CLFPEKPEWDRRGFGVLGAVSGTLACLTALEAMKLITGFSQPLSSELLTMNLHQLTFAKRRSYRDRN
    CPVCGTHSQHYPHPQQLSRVLVNSQ

    >gi|75910455|ref|YP_324751.1| HesB/YadR/YfhF [Anabaena variabilis ATCC 29413]
    MTLTLTEAAEFRLRTFLLSFSKDENSTQRGIRVAVEDGGCSGYQYSIKIINAPQADDMVLQQGKLRIYVDSQSAPLLEGV
    VVDFVDGLLESGFKFSNPNATDTCGCGKSFQAGNCSPAGVPCS

    >gi|75910703|ref|YP_324999.1| DSBA oxidoreductase [Anabaena variabilis ATCC 29413]
    MRQLFQYLRNWVIFGLLCLVLSWSLPVQAASRISPKLEEQVLQILREHPDVIIDSVQVYQQQQQEQVNQIRQAFLQDLKN
    NPQAVIGDSPTTSATQSKAVVVEFSDFQ
    CPYCAKAHDTLKQLLAKHPGEITLVYKHLPLIPIHNEAMPAAKAAWAATQQG
    KFWEYHDALFTNQKQLGETLYLDIAKKLNLDLEKFNSDRLLADAAISKDIQIAQKLAIAGTPFFIMNSKTFSGGIELSEI
    ENKLAEAS

    >gi|75910704|ref|YP_325000.1| rhodanese-like protein [Anabaena variabilis ATCC 29413]
    MNTKLLITPQELTSLLALKSFKTVIIDTRAPEDYAVAHIPESVNIRDFFTYLSADSSPTGLKNLQEYFAKIMSNLGISGG
    ERIIVYEDAFNRGYGQSCRAAFLLKYLGCPQVSVLHGGYQAWLAAGLPTTDEVPQGDSSIFRLRPQAEMIVTTSEMLEAL
    DNPAIIKLDVRDRPEWQGLSSSPYGADFCPRKGRIPNAIWLEWHLFMNSETGIPMFRSTAEILDICQSVGITSESTVYVY
    CFKGSRAANTIMALHEVGIAARNYFGSWNEWSRDFSLPIDSKVIDL

    >gi|75910833|ref|YP_325129.1| thioredoxin reductase [Anabaena variabilis ATCC 29413]
    MSNPTVENLVIIGSGPAGYTAAIYAARANLKPVVFEGFQAGGLPGGQLMTTTEVENFPGFPQGITGPDLMDRMKAQAERW
    GAELYTEDVISVDLSQRPFTVRSEEREFKAHSIIIATGATAKRLGLPSEHQFWSRGISA
    CAICDGATPIFHGAELAVIGA
    GDSAAEESIYLTKYGSKVNLLVRSEKMRASKAMQDRVLSNPKIQVHWNTEVVDVFGNGHMDGVKVRNNKTGEETTVHARG
    LFYAIGHKPNTSLFQGQLELDEIGYVVTKHGSPETSVEGVFAAGDVQDHEYRQAITAAGSGCAAALLAERWLSANALIQE
    FHQEPTINNELETQPVAQKTEAEQEAGFALSATRHAGGYALRKLFHESDRLLIVKYVSPG
    CGPCHTLKPILNKVVDEFDG
    KIHFVEIDIDQDRDIAENAGVTGTPTVQFFKDKELVKEVKGVKQKSEYRQLIEANL

    >gi|75910957|ref|YP_325253.1| thioredoxin [Anabaena variabilis ATCC 29413]
    MSSITNVTEATFKQEVLDSNVPVLVDFWAPWCGPCRMVAPVVDEVASEYEGLVKVVKLNTDQNPTVASHYGIRSIPTLMV
    FKGGRQVNTVVGAVSKTTLTKTLTQHIQEA

    >gi|75911177|ref|YP_325473.1| glutaredoxin-like region [Anabaena variabilis ATCC 29413]
    MFSNREGQRVPQVTFRTRQNNEWVNVTTDDLFAGKTVAVFSLPGAFTPTCSSTHLPGYNELAKVFKENGVDEIVCISVND
    AFVMNEWAKTQEAENITLIPDGNGEFTEGMGMLVDKADLGFGKRSWRYSMLVKDGVIEKMFIEPDVPGDPFEVSDAQTML
    KYINPQAAKPKLVSLFTKVG
    CPFCARAKAALQENGIEYEEITLGKGITTRSLRAVTGATTVPQVFIDGVLIGGSEALAEY
    LSAIKQEKVGV

    >gi|75911202|ref|YP_325498.1| glutathione S-transferase-like protein [Anabaena variabilis ATCC 29413]
    MSIQNTVSGWEELLATARNHTSARRVKRPGQSPSTAPIPSSLHKLPPNTEPPVLLYRDTNSWCPFCERVWFALEEKEIPF
    ATEFIDLSNKPKWYTDLVPTTLVPGAKIEGKLVYESKDILLALEEKFPHPALLPENPEENAVARQLVEEADTNGFRSIAF
    KFLREAPVDVDELAKLQAEFEAQLDELEQTLAKYPGPYFVSTFSLVDIMYSPHLDRLAANLPVYRGYHIKGNPRFPRINA
    WFNALNQRPAYHRVKSDNITNNLLLRRRWGVEPIGNPLPLDVADSEKIQYRAEAAERLSDNREVAIADIIKNSGVQALAA
    DGDFTTVKEAVDFHLRQLADYLLHGNGETLAGGRTGGKNSTVDPIFAAVGAIAFAYLRNRICAPRDMSAGAATAFRAAID
    KLLASVY

    >gi|75911207|ref|YP_325503.1| glutathione S-transferase-like protein [Anabaena variabilis ATCC 29413]
    MAEIKIYSAVVCPYAHRSRLVLQEKGIDFDLIEINLQNKPEGFTDISPYGKVPALAHGNHRVWESAVINEYLNEVFPQPP
    LLPSSPIAKAQARIWIDFANTRFVPAFSALLRSPDIQQQEAAKQELYKHLEFIENEGLGKLSGDGPYWFGESISLVDFTF
    YPWFERWPALKHYRGLALPEEFTRLRRWKKAVKQRDSVVAIANSKEFYIERYARFATPVAA