Hydrogenobacter thermophilus TK 6 uid45927

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|288817401|ref|YP_003431748.1| hypothetical protein HTH_0080 [Hydrogenobacter thermophilus TK-6]
    MRSIALILTNLLAVLVLTIYAQEAHDKTHQAQKEGAILVVNLTHDRGISAEMALTFANISLGRGYETVVWLNSEGVRLAD
    AKAKETQAIKLLREFLSKGGKVYV
    CPVCAQKLKVEKIASGTQWANPDIIFPLITQEKTKIVSW

    >gi|288817545|ref|YP_003431892.1| thioredoxin reductase [Hydrogenobacter thermophilus TK-6]
    MLEISEDVLYDCIIIGGGPAGLTAGLYTARAKLNTLLLEKGTIGGQIAITDLVENYPGFPEGISGKELSLRFKQQAERFG
    LKVAKAEATKIEKSGKEVFVHLRDGRMLRAKTLIVASGSNPRKLGVPGEDKFLNRGVSY
    CATCDGALFDGLPIAVIGGGD
    SATQEALFLTRFGSIVYLIHRRDQLRAQKHLQEKVFSNPKIKFIPDTVVEEISGNEFVEKLILKNTKSGEVSELEVEGVF
    IFIGLEPNTGFLKGSVELDEKGYVITDEKMMTSLEGVFAAGDCRSGSTGQVAVAVGEGCIAGMQAEKYIEDNF

    >gi|288817546|ref|YP_003431893.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
    MAGGVIVLTESNWHAEVINSDKPVVVDFWAPWCGPCRIIAPIIEELAMELGDKVKFGKLNTDENPNIAMQYGIRAIPTIM
    LFSKGEIADTRIGVQPKEALKQMILSHI

    >gi|288817766|ref|YP_003432113.1| dihydrolipoamide dehydrogenase [Hydrogenobacter thermophilus TK-6]
    MEHFDVVIVGSGPGGYMSAKLLLERGKSVALVEKSVFGGVCLNAGCIPKEGLYKLALEKSKPRWKVAVQMVQGKVIEIRD
    TSLKALLSKGLTYVEGDGELIDERVIKVGNRRLTASHIILACGSKQREPGISPEDVLRGWAIPKNNVCIVGGGAAGCELA
    FILSSFGFKVYLVREDTVLKGYRNIPEEFALKLEDALERCGVKLVENTKNVDADLVIRATGRIPNFCQERFPFVAVDERG
    FVRTDSFLETDTKGIFAVGDIVPPMGAGYAFEKARVAVRSILYDKERVFDPRKVPVIISSAYQIGFVGDVKDAKIFVTKP
    LGTNPKAYVTENDGIISVGFDDSGRLVYCCLIGREVGEILNLCATLLGKNLEEHLSFAHPSYGEIINEILSIKQEVCR

    >gi|288817899|ref|YP_003432246.1| thioredoxin-like protein [Hydrogenobacter thermophilus TK-6]
    MRKLLMLIFILPFVAFSAVGIPFLKPSLLNLKDDLEDAKRDGKYLFIMFHQEGCPFCDKMRKVTFQDKAVQEYFSKHFYM
    VEIDIRGANEVVDVDGKKMTERQFAHKYGVRLTPVFMFFDQKGNVVAKVPGYIEPKDFLLIGRYMVEGHYRDTNLVKFIK
    ENKK

    >gi|288817912|ref|YP_003432259.1| peroxiredoxin-like protein [Hydrogenobacter thermophilus TK-6]
    MPLKVGERAGNFELSSYEGKRYSLYETPGYVLLVFYKVTCPTCQLTLPFVEKMYKLYGDAITFYGIVQDSDKDAKEFANK
    YGLTFPQLVDYPTYQVSQKYGVEVVPTLYLLNPEKTIEFVSSSFVKADLDKLNSRLSAVAGKEEVDIFAGTHVPVFKPG

    >gi|288818066|ref|YP_003432414.1| thiol peroxidase [Hydrogenobacter thermophilus TK-6]
    MAQTVTLKGNPVALSGPALSVGDRAPEAVVVTKDLQEKAIGGAKGVVQVIITVPSLDTPVCETETKKFNEMLAGLKGVDV
    TVVSMDLPFAEKRFCESFNIGNVTVASDFRYRDMEKYGVLISEGALKGILARAVFVVDKEGKIAYIQLVPEITQEPNYDE
    VIQKVKSLLS

    >gi|288818125|ref|YP_003432473.1| thioredoxin reductase [Hydrogenobacter thermophilus TK-6]
    MHQLLIIGGGPAGISASIYASRKRMDFVLITEEVGGQVIKAGEIENYLGYAMVDGIAFVEKIIQQMERLGVEPVLDRVIE
    VRKVSDGFVARTLSGKEYSAKTLLFCTGAEHRRLNVPGEKEYTGRGVSY
    CYTCDAPFFRDVKVAVVGGGNSGFEAAQQLT
    HYASEIYLIEISDRFVADEVLRENVLSHPKVKPLLRHRVLEIRGDKTGVREVLVEDLQSRSTYTLEVQGVFVEVGLKPNS
    ELAKSLGVLTTSRDEIIIDCNNRTSERGIYAAGDCTNIFAKQIITAAGEGAKALLSIHHDLTYGVSSWI

    >gi|288818140|ref|YP_003432488.1| molybdopterin biosynthesis protein [Hydrogenobacter thermophilus TK-6]
    MFKFTEEQIKRYARHIILPEVGGKGQEKLLNSKVLVIGAGGLGSPSIFYLAAAGVGTIGIVDFDVVDFSNLQRQILHTTE
    RVGIPKVESARMTVERLNPDVKVITYNVMINKHNIMDIIKDYHVVLDGTDNFPTRFLINDACFFAGKPLVSAAMLRFEGQ
    ISVFDYRNKEQSPCYRCLFPEPPPPGLVPS
    CQEAGILGSIGGIMGCIQATEAIKLLLGIGEPLVGKLLVMDALSMDFRKV
    KLRKDPNCPLCGERATIKELVEYEQVCDVHF

    >gi|288818188|ref|YP_003432536.1| thiol-disulfide isomerase/thioredoxin [Hydrogenobacter thermophilus TK-6]
    MRKISYLLAFLLLGGLLFFAFMHKKEDEEGYSAITPSEQTLPDFTFTGLDGKVYRLSDFRGKIVLLNFWASWCPPCREEM
    PIFEKVYEDCKKNGFVILAVSMDTNTDARDRYLKELKPSFIILEGNDNIKLVGLPTSYLIDRDGRLYKMKLGVYREVKED
    IQSLLGPDKRC

    >gi|288818352|ref|YP_003432700.1| hypothetical protein HTH_1041 [Hydrogenobacter thermophilus TK-6]
    MRFLFVVTSNPFAKDFSTLLYLVNALSKHGEVAIFFSGNGVYYLTRPETKKFKDAGVRLLYCAHSAHQRGIQTASDFFES
    SSTYNLSKMLPDYDKVLVFN

    >gi|288818501|ref|YP_003432849.1| SCO1/SenC/PrrC family protein [Hydrogenobacter thermophilus TK-6]
    MKKLALFITWLALLIFAPSCQKKHEFYGFVYDQPAYDFKLTDQEGRQVSLSDYTRQGKIVVIFFGYTHCPDVCPTALTTL
    ASMMKNLKEDERNKVQVLFISVDPERDTPSVLKGYVPFFYPTFVGLTGSQDEIKKVAKEYKVFYRKVKGESAAGYLIDHT
    ATIYVVTPDMKIKLLYTPTKQSPEKMAKDMEYLLKS

    >gi|288818516|ref|YP_003432864.1| dihydrolipoyl dehydrogenase [Hydrogenobacter thermophilus TK-6]
    MRFDLVIVGAGSGGYEAGLYAHRRGMKVALVELSPESVGGNCLNRGCIPSKYMRHGAYLLEKFQKMPSYGILPKGYDLDM
    KKLREGRDHVVVSIREGFKKFAQQLKIPIFYGRGVIKDERTVYVEGEDIELKTGFILLATGSSTTSLGNLVPDGRYIYDT
    DQIWNLESFPKRMLIVGGGAVGVEFAYIFKMYGCDVVLVEIKDRLLPSNDIPEESSRYLARKLKRLGVDIRLKTSVESWE
    RKGESLNIKLSDGSEVIVDAVLLGVGRKPNTEGIGLENVGIKKDQRGFLLVNEYCQTCVENIYACGDITSPLMLAHKSMY
    EGRVAVSHMLGDRDLKRDERIVPKIIYSAYEIASVGLTEEQAEEMGYEVKVGVVSFVPNPKAMDDGENEGFVRLVVDAEN
    GGILGCHILGPYAGELIHQVVHLMKAGKDVEFLSKSMYAHPSLSEAIGQSAMEVHFGPLTWAKRH

    >gi|288818631|ref|YP_003432979.1| mercuric reductase [Hydrogenobacter thermophilus TK-6]
    MIKLKITGMTCEHCASTVKKALETVRGVERVSVYFPQGYAQVEGKANIEELVEAVRRAGYGAEPLQECIEIYIPKGDVYD
    MFIVGGGSAGFAAAIRASELGAKVLIAENSTIGGT
    CLNRGCVPSKYLIGIANTFYSLKSSPFVSVEKAQIDMRKVLEAKE
    ELLERLRKEKYWNVLDAYPNIEYREGRGRFLGKGKAIVGEREVSFWKALISTGSRPYVPQIKSLDTVRYYTSDSIFNIDY
    VPEHLVVIGGGAIGLELSQAFSRMGSKVTVVEALPEILTGEEPELRERLKESLKREGIEIITGAVVDEVKQEGEIIYVKV
    RAGNTNRVISGTDLLVATGRKPNTGGVGLELVGVKTNAKGFIQTNEFMQTTNKDIYAAGDCVGKFMLVTVAAMEGGIAAE
    NALLGNKREVDYRHIPHAVFTDPELASVGLKEEEAIRMGYSVDVRILEFSKVPRALISFKHDGLIKTVIDKETKRILGIH
    ILAPHSAELIHKAVLLVKYGLTLDDVIRTVDVYPTLSESIKLGAQAFVKDVSKLSCCAE

    >gi|288818648|ref|YP_003432996.1| glutaredoxin-like protein [Hydrogenobacter thermophilus TK-6]
    MLLSLEVRSQLRDILSKELENKVKLKLFSQAIGCETCQVAEELLKEVSQIEPEKIELEVYSPLIERDVAQAYAIERVPTI
    VIEGEKDYGIRYIGLPAGLEFSTLVQGIVQVSKRAPRLSEKTVEMLKSIDKPLEIMVFVTTS
    CGYCPSAAITAMNFAIAS
    DYIKALVVDASENPDLAERFQVVGVPKIVINRGLVEFVGAQPENAFLGYIISAYEKLRREENNGQA

    >gi|288818655|ref|YP_003433003.1| thiol:disulfide interchange protein [Hydrogenobacter thermophilus TK-6]
    MTKKLCILLSSTVILAVSSSCGAPSAKCPSKDAVKNSVKDLIPQDFTVESVSGVKEINGLCEVVIKVGAQPLVFYTDSTG
    NYVVAGNIISLKDKKNLTRERQQEFMKVSTDQLKELEKHVNFTYGQGKKFIYYITDPD
    CPFCKKSEPIIEDWAKKAGVQI
    KVILFPLPIHPQAFGKSVALVCDKKGWEELVKGYESKNQCDEGKKAITDNLQFLSQLGVNGTPTFVGMNGKMQSGVPTEE
    DLNKLIN

    >gi|288818675|ref|YP_003433023.1| hypothetical protein HTH_1371 [Hydrogenobacter thermophilus TK-6]
    MRMPNRLINARSPYLRKSAYQPVDWYEWCEEAFEKAKREDKPVLLSIGGVWCHWCHVMAKESFEDPEIAKIINENFVAIK
    VDRDERPDIDRRYQETVIALTGSGGWPLTAFLTPDGKLFFGGTYFPPEDRWGRPGLKSLLLRISQLWREEKERILKSADH
    IFLELQNYSSMTFKDFVDEELLKRGIGALLSSVDYEKGGIGSAPKFHHAKAFELLLYHYYFTKEEIVKRAIISSLDAMAK
    GGIYDHLLGGFFRYSTDDTWNIPHFEKMLYDNAELLRLYSLAYQVFENPLYEYVAKGIVNYYKLYGSDQEGGFYASQDAD
    IGVLDEGGHYTFTSDELRLLLDPEELKVVKLYFGIDTRGRMPHHQHKNVLFINMDAQQVSKVLDIPKEKVEELLKSAKEK
    MLSYRNSREIPYIDKTIYTGWNGLMIDALCVYYKVFQDEWSLLMAEKTANRLIKERYRDGSLDHTDGVSGYSEDYIYLSQ
    GLLSLFEITQNRTYLDMAKELLDKAIELFWDDQGWGFFDTHQKGEGLLLIKHKPIQDTPIQSVNGTSPYLLLLMEAITGD
    TKYGEYAEKNLMAFSRFMREMPMASHSYLISLYAFLRGVFKVETDGYFWEMMKAFRPFKLVVKGHMKGLLVCEGKVCKSY
    SSPEEIEL

    >gi|288818723|ref|YP_003433071.1| thioredoxin-family protein [Hydrogenobacter thermophilus TK-6]
    MKRLILLFLILLSCSAKDTLPDITVKDIDGKSVNLGSYKNQKLVLYIWSRTCAGHTKDLKKLGHLVKMYPNYKIVSYAVA
    MEAGDVVESYRQLGIAPNFLTLIDTAVKFNDYFPITFLPSTYVFDKGGKLIASYAGLPDKL

    >gi|288818799|ref|YP_003433147.1| pyruvate/2-oxoglutarate dehydrogenase complex E3 component [Hydrogenobacter thermophilus TK-6]
    MFDYDVIILGGGLAYTAAEILRNKGLKVAIVEKNKEHLGGVCLHEGCVPTKLYLFEAQKIYDMKNSRLLEWKGGDVKLKR
    LVEYKERLRKKLREDIERLLKGVDIIYGDGTLTDRHTVVVGERQIRGRYIIVNTGKRQTWGFGLEPDGKRVITTDEAINL
    ESLPEKLQIVGDDYIAFEFATFFAVLGSQVNLYFDNPMSFAHTSIKNRFLKELELLGIALHPIKDFKTESITLLVKRRVP
    NSECVGDLIQKDENNHILVDAHYETSIKDHYAVGDVNGLSETAHAARMQSLIVSKRILGERSFYIRPENIPYVLYTVPLS
    YAKVGLTKMELERRGIKHTEKSVSLRAFSSSYIQHSEDGMCFLYFDSRGFLLGCEVLSRGAGEIISSLTVSLYSELNISH
    MSKVLLPHPTLSEIPFLRLV

    >gi|288818816|ref|YP_003433164.1| thioredoxin [Hydrogenobacter thermophilus TK-6]
    MRKLLLVIVLSLGFGWGGEWWSDPVGGLEEAKKDSKPVMFYFHSEHCPYCLQMETFVFSDEKVSKYMDKFVVISLDIYTP
    TGRAWARRFNVFGTPTFVFYDPKKDAVISISFGSKSKEDFINLLMKTCEKANTKKC

    >gi|288818860|ref|YP_003433208.1| protein-disulfide isomerase [Hydrogenobacter thermophilus TK-6]
    MLMLVLVFLLLIPAFGGDLYSEFVREQVKEIPLSKAIVVGNGNNKLITFINPDCPHCRKEWEELKPHLNRIKIYVFLFPF
    KTAPESYPKAFYIACSKNKLKALDEVLSGKLDGNPPKVKECPLVYEHINIAQKLGVRSTPYNIVLKEYKIIEGYNPELLK
    LLGVR

    >gi|288818897|ref|YP_003433245.1| rhodanese domain protein [Hydrogenobacter thermophilus TK-6]
    MFQVPEVSYEEAKRMLEEDSNVILLDVRTPQEHAQLRIPNSKLIPLDELRYAYKDLPKDKKYIVYCRSGERSAFATYFLR
    HMGYEAYNLAGGILIWPYEKVSGID

    >gi|288818963|ref|YP_003433311.1| iron-sulfur cluster assembly accessory protein [Hydrogenobacter thermophilus TK-6]
    MEKVAMNFFVTEKASQEVLKIAQENNITEPILRIRVVPGGCSGFQYAMGFDDTIEEGDHVFEYGGVKVVIDQFSMPYVNN
    AELDYVMDFMGGGFTIKNPNVTGSCGCGSSFSCG

    >gi|288818973|ref|YP_003433321.1| bacterioferritin comigratory protein [Hydrogenobacter thermophilus TK-6]
    MLKEGDKAPEFCLEGIDEDGKEGRFCLRDFLGKPLILYFYPKDDTPGCTQEACDFRDSMSRLSSMGIRVVGISPDSLSSH
    KKFREKHGLNFILLSDPEKEVAKLYSAYGKKKMYGKETEGIIRSTFFIDESGVIKRAWYNVKAKGHVENVLKSIE

    >gi|288819002|ref|YP_003433350.1| cation transporting ATPase [Hydrogenobacter thermophilus TK-6]
    MRMSLQVDGMTCVNCARSIEMNLKRLKGVKSVEVSFELGRVYVEFDEDLLSSEHIKDVIQTLGYRVSKDVEDKDRSFLIL
    LLCVVLSLPFLPLMIFHTSWSVYLELVLASIIQVIGGYGFYKSAYKSVLSGVGNMDLLVSLGSTSAYIYSLLTMLGLLDG
    KPFFETSVFLITFVRIGKYLEERAKEKATRSLRELFGVQTSKVAVLKDGREEKKSVQEVFIGDVILLKTGELVPLDSTLI
    EGSLEVDESIITGESRPVLKTSGHEILSGSLVISGYGKARVKKTLGGSYVSLLIRLVEDALRQKPNIHRVADRVAHYFVQ
    VVLVLSILVFALWYLKTGDLQKSFSFGLSVLIISCPCAFGIAVPLALTVGLLRAYKRGLLIKNPSVLERIKDINVLLLDK
    TGTLTEGKPKVKEAVFYQDALNLAFSVACTSNHPHAKAIKEYCQSLGAKAIDLPNCKELPGKGIFCGDYFLGNPREVDIY
    RENTTTILTRGHQILAEFHLEESLKEGVQEVLNYLRSRKVKPVMITGDSQERAERVAQALGIDEFYARVKPEEKLLILEA
    YQKKGYKVGMVGDGINDAPAMAKADVSFAIGSGTDIAKRVGDVVLVSGIESLRWMFDIADRVNMRIRENLFWAFLYNMLG
    IPIAAGVLSPYGIVLKPEMAGFMMALSSLSVVINSVRK

    >gi|288819076|ref|YP_003433424.1| glutaredoxin family protein [Hydrogenobacter thermophilus TK-6]
    MKEIKVISTSECANCQLLYNAVLTIVKVKGIDAKVEKVIDVKEVVKYGVMTTPLLVVNGVLKHVGTPIPSPQKLEELLSD
    V

    >gi|288819142|ref|YP_003433490.1| alkyl hydroperoxide reductase [Hydrogenobacter thermophilus TK-6]
    MMVGKKVPNFELEVYDPQKGGFGKVSLQDMRGKWVVLFFYPADFTFVCPTELADLAEKYQELQELGVEVISVSTDTKYAH
    LAWHRSEKLLEKVRFPMGADPTGRVSRLFGIYDEENGLALRGTFIINPEGVLVGSEVNFYNVGRNAEELLRKMKANVYLM
    HHPEEACPAKWTEGKKTLKPSEELVGKVYQALS

    >gi|288819143|ref|YP_003433491.1| thioredoxin reductase [Hydrogenobacter thermophilus TK-6]
    MELSLDFKTDKVYDVVIIGAGPAGASAAIYTSRAGLSTLVLYRAEADGALGVTQQIENYPGIRGPISGYELLKLMREHAK
    AFGAEFVRGKVIATDLLNEVKKVYTIDGREFKARAIIIASGAMERTNKYKGEEEFLGKGVSY
    CGVCDAAFFKNRPVAVIG
    EDDYALEETEFIARFASKIYLVVPSSRIKAPPEIIEEVQSKEKVSILLHHRVLEIVGTSLVEGLKVQDVKTKEIKLLEVD
    GVFIFLGGNKPSVDFLMNQVEMTDEHCIVVNEEMMTSVPGVFAAGDVLCTNIKQAVIAAADGVKAALAVDKYLNKKAKIT
    SQW

    >gi|288819172|ref|YP_003433520.1| hypothetical protein HTH_1875 [Hydrogenobacter thermophilus TK-6]
    MKVIILMTSGPKTPWRCASPFYIAALMAANEAEVEVFFNMDGTNLLKRGVAQRILPAEPNCLSPNGKKPKTVYDFMKDAK
    QAGVKFYS
    CKQAVDSLGLTREELIEELDGIVPASEFALRAMEADKVLTF

    >gi|288819173|ref|YP_003433521.1| hypothetical protein HTH_1876 [Hydrogenobacter thermophilus TK-6]
    MGAKDKHVILLVSQWCATCPDADMLWRKLQAEYGFKYDVLDVAQPEGKMWAKKLIVRSVPSTIIDGKLTFVGVPDEAEAR
    KVIES

    >gi|288819175|ref|YP_003433523.1| heterodisulfide reductase subunit B [Hydrogenobacter thermophilus TK-6]
    MGVIGKRVAYYPGCSLEGASRAYDVSTRIVAKELGLELDYLEDYNCCGAMESKNVTFMGTMLLNARNMSLARKQGHDVIV
    APCNGCSFSLQRAEYFLETDRNVFERVNALLREGGVDQLDKIPHTYHILEWFYHEAGPQKVKEKTKRPLRGLKVANYYGC
    LYTRPHFYARTYAHAGGQEEEVRPRKRDTADDDEHPYYMNALLEAAGATSVEFEPMHTQCCGGPHSLSDEQVSEKFVMMI
    LQTAKRNGADIIATE
    CPLCHASVEMYRHRLMMKGVPDVDVPAAYFTQLLGLAFGYSANDVKLKDNLSDPLPVLKRLGLA

    >gi|288819181|ref|YP_003433529.1| hypothetical protein HTH_1884 [Hydrogenobacter thermophilus TK-6]
    MAAQGYEKLIFYILTVPFFERAEPATGELINPQAGAPFFLATAATTMDYEVEMVITSEAGFLLMRDNAKKVKVRPGVEQT
    VYDFIKMAKDAGVKIYL
    CVPSLDLTEIYKKEDVNPELCDGIIGGAAFLDKLMSGEYAVITL