Hirschia baltica ATCC 49814 uid59365

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254292399|ref|YP_003058422.1| thioredoxin [Hirschia baltica ATCC 49814]
    MDISSGSFPPNGEDAQWIIDGSDQTFMQDVVEASKHSLVLVDFWAPWCGPCKTLIPSLEKVVNQANGEVRMVKINIDENQ
    GVAGQLGVRSVPTVFAFKDGQPVDGFQGAIPESQIVEFIKKAGAGGALEQIEQALAAAAQAFQDGELDQSAAIYAQILQA
    MPDNVDAMVGMARCFVAKGEYDRAKEVIALIPEESQKMPQVKSVLTAIELSDDGGSTDDASSDLQAKLSVNPDDFEAKFN
    LAKSLSAKGNHQDAANQLLEILEKDLDWNEGAAKEQLLKIFEAAGPTAEVSKSGRRRLSSLLFN

    >gi|254292410|ref|YP_003058433.1| OsmC family protein [Hirschia baltica ATCC 49814]
    MSVKVAYTTKATATGGRTGSAKSEDGQLNVTLTTPKELGGPGGDGTNPEQMFAAGYSACFIGAMKAVAAQDTSVKVPDDV
    SVTATVGIGPRSEGGFGLEVALEVNLPGVDQEAAQALIEKAHQV
    CPYSNATRNNIDVQLSLA

    >gi|254292473|ref|YP_003058496.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Hirschia baltica ATCC 49814]
    MKRAIYILPIVLLLVLAVLSVVKLGQVGEPKSDLFKGKNRPAPEIVLTTLDQSEFRLADELGKPVIVNLWATWCLPCKLE
    HPYLMEMSKQVSIVGIAYKDDSDAIQTMLKVDGNPFSVVALDGDGMAGLDLGVNAVPETFLIDGDGMIVRQHRGPLSREE
    ADAFIAQYQTLREAGQ

    >gi|254292487|ref|YP_003058510.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Hirschia baltica ATCC 49814]
    MKSLIAASFLSFAMVMPALAAPRLGSEAPDFEAVSTNGEAVKLSDIDGVVVLEWTNDGCPFVKKHYESGNMQATQKTLTE
    GGAKWITIISSAPGKQGYVDAEEANSIAAEHGAMPDYTILDPTGDIGKLYKAQTTPHMFVIEDGILEYAGAIDSIPSGNP
    ADIERAENYVLSAFADIQAGNEVQTASSKPYGCNVKY

    >gi|254292493|ref|YP_003058516.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
    MIGRQVPKVTFHTRVRDESIGGDNPFRWEDKTSDDYFAGKKVVLFSLPGAFTPTCSTYQLPDFEKLFPEFQAKGVDAIYC
    MSVNDTFVMNAWAKGQGLNNVSVIPDGSGEFTRKMGMLVNKDNLGFGARSWRYAAIVDDGKVTKWFEEPGFEDNCGEDPY
    GESSPQNVLKNL

    >gi|254292506|ref|YP_003058529.1| peptide methionine sulfoxide reductase [Hirschia baltica ATCC 49814]
    MMNYKTLFFTSSVALLASCSQSTAAPNVAESERLDTKPEITKTIVVAGGCFWCVESDFDKVDGVVATISGYSGGHVDNPT
    YKQVSREDTGHYEVLQIEYDPETVSFDELLTYYWRHVDPTDDGGQFCDRGDSYKTAIFVNDENEQQIALKSKSDLENSGV
    LEAPVVTPILTAAPFYPAEIYHQNYYKKNPLRYRYYRSSCGRDKRIEQVWANNETAHK

    >gi|254292559|ref|YP_003058582.1| arsenate reductase and related [Hirschia baltica ATCC 49814]
    MIVIYHNPDCGTSRNVVEMVKASGADPVIIPYLETGWTRAQLLGLFAAADITPKEALRTTKSPTMDLGLLENDVDDDAIL
    NEMIKHPILVNRPIVCSPKGVKLCRPSEAVLDLLETPLAETFTKEDGEQIG

    >gi|254292616|ref|YP_003058639.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
    MPKAITRFGIPAMLIVGGLFVVVALFSASNQPKTGSSGLKRYAKGDLASLELSAGKAAPSGEFDNAEGKAVSLQDFNGEV
    VVLNIWFEA
    CPPCEEEMPSLGRLQEAVQDDGVRVVAVAVDREYNRENTRKSLEQWTNGVLDFYFDTTYGIAYDTGAKGMP
    TTIIYNRNGEEVARFSGGADWSSENAIALIKEIASTK

    >gi|254292646|ref|YP_003058669.1| arsenate reductase and related [Hirschia baltica ATCC 49814]
    MTYILLTNPACSTCRNGLALLQENGIEPTLRKYMNVSEQLSVEELRDIAKKLGNVSPKAFARPKNIQAEGLDPDMDDDAM
    FAAMAENPKFIQRPILIKGDEARLGRPIEKMLELI

    >gi|254292774|ref|YP_003058797.1| Carboxymuconolactone decarboxylase [Hirschia baltica ATCC 49814]
    MTEYTLHTAETAPEASKEILEGAQKANGFVPNLYATMAQSPELLKSYKYLAEAFSSNSLTTDERNVVWQVINYENNCHYC
    VPAHTGIAKSQGISDDVIEALREGKTIPDAKLEALAEFTRQMLAQRGVVTDEQTQALFAHGYDTTTVLDVILGLAHKTLS
    NYTNHVAHTPVDDAFSKFAWTHPDER

    >gi|254292808|ref|YP_003058831.1| methylated-DNA/protein-cysteine methyltransferase [Hirschia baltica ATCC 49814]
    MLTLFKEIIDGPFGHLSLIIDEAENLRAVEWEDFDARCQKLLVRHYGENGFTLNLAQNDQPSTTASALIDYFAGNLSALN
    HIKTATGGTLFQQKVWTALRTIPHGQTLTYGDLAKQIGNPKAVRAVGLANGANPIGIVVP
    CHRVIGTNGKLTGYAGGVDK
    KRWLLEHEGAIPASLSLDV

    >gi|254292970|ref|YP_003058993.1| glutaredoxin-like protein [Hirschia baltica ATCC 49814]
    MTAQETIQKAVTSNDVMLFMKGTPVFPQCGFSSTVAQILNYLGVEYNSINVLEDQEVRQGIKDFSNWPTIPQLYVKGEFV
    GGCDIIKDMFEQGELREYLEEKGIATANAEQ

    >gi|254292985|ref|YP_003059008.1| hypothetical protein Hbal_0609 [Hirschia baltica ATCC 49814]
    MKTIKSSLLTTFTLAATALMMSFTSPASAQEVYLVNLTAEWCPNCKILDPRIDQAADRFKDGSVERVELDFTNGDTMSEA
    FKKVNGTFIAGVFADYAGLTGLAVLVSADSGEKIDCINRTMSTDAIEMQIVAAREIVRTTPIGKRETGSIMCPAPNKRVQ


    >gi|254293059|ref|YP_003059082.1| hypothetical protein Hbal_0686 [Hirschia baltica ATCC 49814]
    MSDEIETKTGNKKKSGWFASGGVLTSFFAFLGASCCVLPFILVNLGISTTIVGKLGFFVRYQSIFQWLTLGLLGAATFFA
    FRYGRPRMRVIILLVIGFIFAGMAYLLPSYEKEILEWLNLR

    >gi|254293168|ref|YP_003059191.1| glutaredoxin 3 [Hirschia baltica ATCC 49814]
    MAKVTIYTRMMCPYCTRAVSLLKKKGVDFEEIDAGMDAAKKQEMIKRSNGGATFPQIFIGNEHIGGCDDMMALESKGALD
    VMLG

    >gi|254293253|ref|YP_003059276.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Hirschia baltica ATCC 49814]
    MPSSLDEVAMKKSTKKRLKADLVVIGAGAGGLSAAAGAAMLGLKVVLFEKGKMGGDCLNFGCVPSKALIASAKQAQAFRT
    ADKFGLTSADPGVDWKRVKEHIQGAIGTIEPNDSQERFESMGVTVIREEAHFVTEHVIASQTTQVKAKRIIIATGSRALI
    PPITGLEDIEYLTNETLFDIDVLPEHLAILGGGPIGIEMAQAFRRLGAKVTVIERSKALSCVDEEHAALALRKMREEGVE
    VLEQHAVNAVSTTGAGIRVEVQNAANEVSALTASHLLVATGRVQFFDTLALEAGGVEYDHLGIKTKPNLRSVSNGRVWAL
    GDAAGRGQFTHLAGWHASVFVRNALFKSATRADSLPVPMVTYISPEIGQVGLTEAQARKEYGDKVKVSKFEFDDIDRAIA
    EKDTVGGAKIVALKNGTVLGASIVGEGAGDIIQLAGLAMSNGLKIKALTNFISPYPTRTEILKRAASKWYEPLVFGKKAK
    FIVKILQAF

    >gi|254293305|ref|YP_003059328.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Hirschia baltica ATCC 49814]
    MMFVLSACYDEDSGNESSPEVVSEKPNPVQNTASKPIDHDNHGRPKTYKLVGQKAPVFSTTSSQGETISSADLEGRWTVV
    NFWGLY
    CHDSLNDAKYANALKTAIDQDPDLNYLSIHTAPMEKQLSRPFGKWGAIETFFQDKGYDEYPVALDIDAEIRDIF
    NIEWTPTYLLIGPDLTIESFRTDFSVDSKNGIKDFIKKVQNIKKKKTDQSARPSVVEQAYNAAPAATISSAGVAGLSSQT
    PFDMWAIQQAFDGYDVRAVRIETPQKDLETYEIYNEQELVMLISPDETGDWVGDATAVTPEFKGPLGETIGVSRLGDIPK
    DILGKCEHEIGFYKNALTCRSDNISRFARIFEIPDNYATSSGNIPSEVRQASKLIGLRFIPDNRVF

    >gi|254293320|ref|YP_003059343.1| cytochrome c biogenesis protein transmembrane region [Hirschia baltica ATCC 49814]
    MRAFVFVFAFLLSLFSQNAAFSAPVDAGNATVEVIAERSVIAQGDRFLGALKLDIDEGWHVYWRNAGDAGIAPSIAWEIT
    SGAQIGEFYWPAPHTIPLETLMNYGYEDQLVLPFEIVVPSDLNVGDNLIMTGKAEYQICLDICIWENADIDLVLPIADMP
    EADAENSRLIASALEASPIDMTGKATTTLEGEDTLRLSIADEAFAASLADADHVRFYPYEHEIEHFPEQSLRVGEQGGTL
    NLQLSSLSKIEPTPIEGIVVVDKNDKTRFAMKVQAQIGDVLAGTDDIAASNSHAKQAVEIAATASFSQILVWLGFAFVGG
    LILNLMPCVLPVLTIKANGLAHAAQQGQSQLKSHGIAYLAGVLTCFVAIGIVLLMLRAAGEQAGLGFQLQYPPMVLGLAL
    LMFIVGLNLLGVFEIGSSVMGVGSNLANKSGVAGAFFTGLLAAVVGAPCVGPLLAASLGAVVSQPAWVVILFLIVMGSGL
    AAPFVLLSFVPGLAKAMPKPGGWMDIVKQVLAFPMFLTSIWLLWVFAGQKGVDAAIMVLTAAVVIAFALWMFARPNANGL
    AKSVAGVLMLCAVIVPFVLTGGASHVNEVASSDITTKSGVEVKTGDWSPEYVEELRAAGTPIFVDFTARW
    CVTCQMNKRI
    ALHTDKVKNAFAEQGVVFLTADWTNRNKLIADELARHKRAGVPLYLYYPPQGDVQILPQILTAGLVAKTVTP

    >gi|254293381|ref|YP_003059404.1| DSBA oxidoreductase [Hirschia baltica ATCC 49814]
    MTINLDMVSDVVCPWCWLGLRRVEAAIEIFGSDKVTLNMRPFQLDANVAPEGVDYKEYMRNKFGDTSSDNKWTQMREHLE
    AAGQAENIPFRFDGIPKRANTFNAHRIIRWAQGQSVDGKSLGPKAAEAFFHAYFKRHKDLNDTQTLLSLSEQIGLIPEVI
    EKLLGEDADVKSLQEEEAFFRNLGVSGVPTFIANGKYAIQGAQEVSALVIFLEQVEAGPNIPEEPA

    >gi|254293383|ref|YP_003059406.1| methionine-R-sulfoxide reductase [Hirschia baltica ATCC 49814]
    MTHSDKNKAFWLSRRSAFVFLGGGAVFTSGALVANGFGKDPQTTDADTSHATSDAPKTAPGFDTLSQNQWQNLTKADWRD
    RLSEDAYKILRNEATERPFSSSLNDEKRDGWFACAGCGQILFTSDQKYNSGTGWPSFSDAIPGRLKTKADRKLFYTRTEY
    HCSRCGGHQGHVFDDGPKPTGKRW
    CNNGDALVFVPEADLS

    >gi|254293403|ref|YP_003059426.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
    MTISKGDTLPEFNFVVMGENGPEPLSTKDLTSGATVALFAVPGAYTPTCSVSHLPGYLNNAEALRAKGVDKIACISVNDV
    FVMDAWGKSSNVGEDIIMLADGNAEFADLTGTQLDGRGFGMGPRCKRYSMLIKDGKVVELNIEDGGEFKVSSAEYMLAQL


    >gi|254293408|ref|YP_003059431.1| Glutathione S-transferase domain protein [Hirschia baltica ATCC 49814]
    MKLYFKTGACSLASRITFNELGLPFSSEAVDTDKGLTQSGADFKTINPNGYVPVLEVSQGIYLSENPAILQYIADQKPDS
    TLAPVNGTLERARLQEALNFTGSELHKAFSPFFRIPDMSDEVRSEHIKNLYKKVQHIENQLSDGRTFLLGEDFTIADAYT
    IVVLNWANFINVDLSQYAKIGAYLKNGFARPAVIKSLKEEGIYQEETA

    >gi|254293429|ref|YP_003059452.1| DsbA oxidoreductase [Hirschia baltica ATCC 49814]
    MRTKHLLSAIAIAALTVGCSQADSKPVAANDVKGSSVSYVAGDVILGNADAKVQIVEYASTACGHCRTFHKTILPNIKKD
    FIENGSVSLIYRDLPTPPAQLAAAGAALARCAGKDEYYKVLDDVFTSQGEIFDAARSAGGALPAYNEIGARHGMSEETVK
    ACVTSTEVLNEISRTSDLAQAAGVTSTPTLFIDGVKVEAKDMSNEGIAALLNDALGIETTSESAPAEPEEAAEAAH

    >gi|254293471|ref|YP_003059494.1| thioredoxin reductase [Hirschia baltica ATCC 49814]
    MSNTEHRSLIILGSGPAGYTAAIYAARAMRKPMLIAGMQPGGQLTITTEVENYPGFAETIQGPWLMEQMKGQAEHVGTEI
    VEDHIKSVDLNNRPFTLIGESGTTYTCDALIISTGAQAKWLGLDSEKKFQGFGVSA
    CATCDGFFYRGKEVIVVGGGNTAV
    EEALFLTNFASKVTLVHRRDSLRAERILQERLLNHEKVEVVWDHQLEEVVGDENPLGVTGVKLKNVKTGEIIDREAHGVF
    IAIGHAPATSLFDGQLEMKQGGYLITAPDSSKTSVPGVYAAGDVTDDKFRQAVTAAGMGCMAALESDHFLAELELNNK

    >gi|254293581|ref|YP_003059604.1| methionine-R-sulfoxide reductase [Hirschia baltica ATCC 49814]
    MSNDNQTGKTDEQLRKELTPEQYKIAREDGTERAFTSPLNNEKRDGEYLCVVCETALWSSAHKYDSGSGWPSFYQPAFEE
    AVSTKQDFKLASPRIEVRCANCDAHMGHVFNDGPAPTGLRY
    CINGSVLKFIPEE

    >gi|254293642|ref|YP_003059665.1| OsmC family protein [Hirschia baltica ATCC 49814]
    MAHRSQVQIPGSLGHKLAARFELPAGTPRGFAIFAHCFACSKDQFATARIARQLVQLGVGVLRFDFTGLGFSEGDFSDTT
    FSSNIDDLVAASQWMEEQGMAPTLAIGHSLGGAAVLAAASKLPTVKAFVSIAAPSCAKHVTENFGSQISEIETKGEADVQ
    LAGRTFKIKKQFLDDVEDARVIESVRNMKRPLLVMHSPIDQTVGIENANDIFMAAMHPKSFVSLDDSDHLLTDREDAKYV
    AGVIAAWATHYAIAARKDKASVEPVNGNEPVVVEETQRGSYENWVVTGDYRGVADEPVDVGGDGAGPTPYQYMNAALGA
    C
    TSMTLRMYAQRKGWPVDKVSVSVTHEKSRNEVDSSDLDVFNREITILGDLNAEQRTKMMEIADKCPVHRTLHRVSSIHTT
    EST

    >gi|254293680|ref|YP_003059703.1| Rhodanese domain protein [Hirschia baltica ATCC 49814]
    MKPHRSKRFILAAITSVIASLTFMTATAETELISVEDAYEKSINGEVILVDIRTPQEWTRTGTPLSARLVTLQSERFLST
    INALQAERPDASVALI
    CRSGTRSTRAAQILEEAGIKHIYNVKEGVEGSPNGTSWISKGLPLDRFPLE

    >gi|254293706|ref|YP_003059729.1| Rhodanese domain protein [Hirschia baltica ATCC 49814]
    MTEIHFDSPLVSAQWLKTNWGRKGLKIVDATYMLPFLNPEKSGEQLFEDCHIPDAVFFSLDEIADGSSDLPHMLPNPIHF
    SAEMSALGISNDDAVIVYDQNNWIASARVWWTFRAMGHTNVAVLNGGLQAWKDVNGGFEQGPIRKPHSGVYQANLNASLV
    ANLEEMRAHVTKQNKQIIDARNSARFLGEAAEPRAGLKSGHMPGAFNLPHSALLRDDGHFQDSETIIDVLTEIGLDLNQP
    IVTT
    CGSGVTASILALGLAVIGREEVAVYDGSWSEWGGTEYCPVHTKADLES

    >gi|254293756|ref|YP_003059779.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica ATCC 49814]
    MQDKVTITASAADRIKFILKDNGNASMLRIGVLGGGCSGFSYTFDFANETNEDDIVFERDDAKVVIDETSIPFLEGCEID
    FVNELIGSSFKINNPNATASCGCGTSFSV

    >gi|254293812|ref|YP_003059835.1| iron-sulfur cluster assembly accessory protein [Hirschia baltica ATCC 49814]
    MARRPRPKIVTLSDAAAKRVKEIMSERGAGFLRVGVKNGGCAGMEYVMDYAQAPEPLDERVADNDVEIVVDAKAVLFLLG
    SQIDYEVSPLHSKFVFRNPNQTDACGCGESVTIAPFEDVAE

    >gi|254293979|ref|YP_003060002.1| dihydrolipoamide dehydrogenase [Hirschia baltica ATCC 49814]
    MISKKCKLLIIGAGPGGYVCAIRAGQLGVDTIIVEESHLGGTCLNVGCIPSKAIIHASNEFEKARENAKDNPLGIRADAP
    EIDFSKTIDWKNGIVDRLTQGVAGLLKKAKVQHVNGRANFIDGKTVDVTTAGGIVRISTENVVIATGSKSIELPSLPFGG
    KI
    CSSTEALELRKPPKKLIIIGGGYIGLELGMAYAKLGSKVTIVEASANILSMYDDDLRKPVEKRMKELGITLHCEAQAQ
    TMSEDGKALLVSIKDKEVRIPTDKVFVTVGRKPNLTEFGLEKLSLVMNGSFLKISNKCLTSMRDVYAIGDVTGEPMLAHR
    AMAQGEMVAEIVSGSKRVWDKRCIPAVCFTDPEIVSVGMSATDVVKNGIEVVTGKFPFSASGRAMSTEREDGFVTVIARK
    DNHEVLGIQGVGAEISELSGAFTLAIEMASTLEDLSMVIQAHPTRAEALQESAFSALGRSLHM

    >gi|254294039|ref|YP_003060062.1| heavy metal translocating P-type ATPase [Hirschia baltica ATCC 49814]
    MTLSGRSIDLNASEIAGCPSGLAPKESDETALLVDPTAFVKRSADEYSLDILVRGAKCGGCLSKIENGISELAGIDAVRM
    NLTTGRLHVSWKTKSLQSADIISKISSLGYGATPFDPEEADNEHSKRERQLLMAMAVAGFAAANVMLLSVSVWAGVDEMN
    AETKEFLHWISACIALPVVAFSGRPFFSSAISAIRAGHVNMDVPISLAVLLAVCMSLYETIHHGNHTYFDAAVMLLFFLL
    IGRFLDAKLQREAQSAARDLALMQTGSVTRINADGGAESVKASTLIPDDIIQVAAGERFAVDAVLISGCSELDNHMVSGE
    STPIISQIGQTIYAGTINLTSSIVARVKSSAENSMLAEVSKLLEIGEQQRSTYRQIADKAAKLYVPVVHTVSAAAFLGWM
    LYNGDFKTAIFIAISVLIITCPCALALAAPVVQVVAVGKLFKKNVYLKSGDALERIAACDYVIFDKTGTLTKPDASLKDN
    NIDLNHLELAARLARGSRHPYSRALACLAGPGEIASNIEEISGCGIQGVIDGKNAKLGSLKWVTGVASSSKDIPSLYFQY
    DDDEPVAFEFDETSVLGADCIATELDERGFKVELLSGDVHNKVAAFARKSNIELYSGSISPLEKAERIATLQSEGRKVLM
    IGDGLNDAGALANAHASLTPGGAADVSRAASDGVFSGDDVLVIADIIDIARRSRSRMLENFGFAALYNLVAIPIAVFGFV
    TPLVAAIAMSGSSLIVTLNALRLNLTQAKRVK

    >gi|254294047|ref|YP_003060070.1| dihydrolipoamide dehydrogenase [Hirschia baltica ATCC 49814]
    MADAKNQFDLIVVGSGPGGYATAIRASQLGMKTAIIERAELGGICLNWGCIPTKALLRTSEVFHMMENAEAYGLGKVKPV
    AHIEKIVERSRGVSKQMAGGVAFLMKKNKITVIEGTASLKAGKPAPHVIVKDGKGAGTYTSKHVIMATGARARAIPQAGL
    VPDGDRIWSYREALVPKEIPKKLLVIGSGAIGIEFASFYNTLGSETTVIEALDRILPVEDADISNFVDKQLTKQGMKLVK
    SAQVQGLEKGKNSVTASVKLKDGKIEKITADVVIVAVGIVGNVENTGLEEVGAKIDRTHVTVDGFGRTGVPGLYAIGDLT
    GPPWLAHKATHEGVVCVEKIAGKNPHEFKTDNIAGCTYCHPQVASVGLTEAAAKEKGHKVKVGRFPFIGNGKAVALGEPE
    GIIKTVFDEKTGELLGAHMAGAEVTELIQGFVIARQGELTEAEIMETIFPHPTLSEMMHESTLDAYDRALHI

    >gi|254294122|ref|YP_003060145.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Hirschia baltica ATCC 49814]
    MNEELSSGLSAPDFEIKTSIGHTLSKESFKGSNLVLFFYPKDNTPGCTTEALEFSQKLAEFESLNTKILGISKDSLKKHE
    NFITKHNLTIELGSDEDGIVCESYGVWKEKKNYGKTYMGIERSTFLIDTNGDIVNIWRKVRVKDHVETVLQSVRTIIL

    >gi|254294210|ref|YP_003060233.1| glutathione-disulfide reductase [Hirschia baltica ATCC 49814]
    MSYDYDLFTIGAGSGGVRASRIAALTGAKVAIAEEFRTGGTCVIRGCVPKKFMVYASEYRKAFKDAKGFGYTIPEISYDH
    KAFITSLGSEVDRLSGIYARNLNNAGVELIHERAEIVDAHTIKLVKSGKTVTAERILVAVGGTPFVPGEFEGAEH
    CISSD
    QIFDVEELPKSIVIGGGGYIAVEFAHIFAGLGVETHLVYRGDTVLRGFDDDIRTAVHQGMVQAGVHVVTSAVFEKVSKTS
    DSDHQYKVELSNGHAIDADIVMGAFGRSPYTKGLGLENAGVELAANGSIKVDEWSKTNVPTIWAVGDVTDRVNLTPVAIR
    EGHAFADTEFGGKPHHFDHDKIATAVFTQPPVGTVGLSEEQARAEHGEIDIYKSDFKPMKNALSGDQSRVLMKIVVRASD
    QVVLGCHIVGPDSPEIIQAVGIAVKMNATKQDFDNTCALHPSLAEELVTMRTKFVPT

    >gi|254294257|ref|YP_003060280.1| DSBA oxidoreductase [Hirschia baltica ATCC 49814]
    MNMGSTIKTTLASAALIFAASCSQAVSEPAGKVSTTDKAAIEKIVHEYLVANPEVLVEAFQALEAKQELAEAEQKKQFLP
    AFLALENAPILGDKDAPITIVEFFDYN
    CGFCKKSTDWVMTQVASKDVKVIFMELPVLDSRTKTSALAARASVAASMQDKY
    KELHIAMMKANGLTKGRILSIAEKEGLDVQQLSKDMESATVYRLLEDTMKLAEQADILATPSFYVNGKFVSGANFPMLDK
    YISEARG

    >gi|254294280|ref|YP_003060303.1| Rhodanese domain protein [Hirschia baltica ATCC 49814]
    MSTLTKIPPKDTAAKINAGEAVLIDIREADEYAREHIEGARSLPASTFDSAQITLNAGQHAIFHCKSGMRTDSHCERLST
    LIDGEAMMLEGGLDAWRSNGLPTIKNSKAPLEINRQVQITAGSLILAGFLLGHFLQPEWHILSGIIGAGLMFAGISGWCG
    MGKLLAIMPWNKTAQ

    >gi|254294355|ref|YP_003060378.1| glutaredoxin [Hirschia baltica ATCC 49814]
    MTHSNLPILYTFRRCPYAMRGRMALHVCGQAFEWREILLRDKPAAMLEASDKGTVPTLVLGEDKVIDESLDVMLWALSIN
    DPEGWLPINAMDRAVTYDLIERNDGPFKAHLDRYKYAYRYDDVDGIEHRTAGFETILDLESRLKNQAYLAGDIMGLADYA
    IFPFIRQFRIADMEWFDAQDIPHVHKWLQAAMASEIFEAIMVKRAPWKEGDTPIIYPVER

    >gi|254294358|ref|YP_003060381.1| Rhodanese domain protein [Hirschia baltica ATCC 49814]
    MTQIIVAALYHFAKLPNYEELQVPLLAACEAAGTKGTLLLATEGINGTIAGSREGIDAVLAHIRSIPGLEATEHKESFAK
    EMPFLRMKVRLKNEIVTMGVPGTDPSNIVGTYVDPEDWNDLIAQDDVILIDTRNDYEVQIGTFKGAVNPKTTTFREFPEW
    FEKFQRTHNKPKVAMFCTGGIRCEKSTALAKDMGFEEVFHLKGGILKYLENVPEEKSTWEGECFVFDQRVSVKHGLELGS
    YDQCFACRRPITRADIDKPEFTKGVSCHQCYDEYSPEKKAAFEERQKQIELAKKRGKSHVGQDLTAERVAARLAAEEARL
    KSIAGKESAGE

    >gi|254294593|ref|YP_003060616.1| dihydrolipoamide dehydrogenase [Hirschia baltica ATCC 49814]
    MSETFDVVIIGAGPGGYNCAIRCGQLGLKTAIIEKSSTLGGTCLNVGCIPSKAMLHASELFDEAKNNFASLGIETGTVKL
    NLPQMLKQKEEAVKGLTEGVAFLMKKNKVKVFNGTGRIAGAGKVVVEGKDAAELSAKNIVIATGSVPTNLPNIAVDEERI
    VTSTGALSLSSVPKKMIVIGAGVIGLELGSVWSRLGAEVTVVEYLDRIIPGSDMEVAKTAQKILTKQGMTFKLGQKVTGV
    EKLKSKLKLTMEPAQGGDPEVIDADVVLVAIGRKPYTEGLGLETVGITPNQRGVIENNHFKTGADGVWVIGDTTTGPMLA
    HKAEDDGAAVAELIAGKAGHVNYDLVPGVVYTSPEIAWVGKTEEDLKAAGVKYKVGKFPFMANSRARCNHTTDGFVKIIA
    DATTDEVLGAHMVGTGVGEMIAEVCIAMEFKASSEDIARTCHAHPTQSEAVRQAAMGVEGWTMQM

    >gi|254294605|ref|YP_003060628.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Hirschia baltica ATCC 49814]
    MKSVLGAVLTASLLLSAPLALAEDHKKKDHVQEIGLAVGKAVPTVEDEAIGVVSSAGDVTSLPALMGEKGVTVAFVRSAD
    W
    CPYCKKQMIDLDKIAPQLEKLGFPLVALSYDAPETLAKFKEKHELSYTFVSDTDSANIKAFGLLNEKYEVGSRAYGIPH
    PAVMVISSDNVIVEKLMEEGYKKRPASEAVLEAVQSVQQETVE

    >gi|254294634|ref|YP_003060657.1| glutaredoxin [Hirschia baltica ATCC 49814]
    MSKFAKMPTTYSKQPSKLLVYRWGGAFGPFKVNIPCGECTLTKDIIETTLEDELSGTHVEVEYKDWLTHLPEAILKGARH
    APAVLLNGKVISQGVAINRGTLAAAVMVDHVDRYPIEGNHVFGKKN
    CGYCTKAKEFLDAQGIQYIYHDVVENPAALYEMI
    TRAKQNVGGKTPITTPQIWLDGRYVGGYDKLVETFEKVEEVAAGAA

    >gi|254294695|ref|YP_003060718.1| thioredoxin [Hirschia baltica ATCC 49814]
    MTVIDTTDDKFDEDVIQSEGTIIVDFWAEWCGPCKQVSPHLEALAKEKEGEIKIVKVNVDENPMTSGRFGVRGMPTLMIF
    KDGKVAATHLGAMSKSRIEEWVAESA

    >gi|254294802|ref|YP_003060825.1| peptide methionine sulfoxide reductase [Hirschia baltica ATCC 49814]
    MTILDKSQLVSKENALPGRDQELATAQTHFLSGAAIKADIPTGFGEIYLGLGCFWGAERRFWETEGVYVTSVGYQGGYTP
    NPTYEEVCSGLTGHTEIVHVVFDPSIITLEGILKVFWEAHDPTQGMRQGNDLGTQYRSAIYAVNEADLERVNASKAAYQA
    ALNKAGRGGAITTEISLAGPYYYAETYHQQYLAKNPSGYCGLKGTGVACI

    >gi|254294927|ref|YP_003060950.1| Glutathione S-transferase domain protein [Hirschia baltica ATCC 49814]
    MTNITLYYTPLTCARVTFTALEETGHPYDIELVNWLDEENWKNYLAINPHGKVPALRIDDNILTENAAILLHLNEYFPKA
    NLLPTASEKFGKNDIIQDIIWCSSTIHPITRMIRMPMRFNRSGDTDGIISLGKEYYKPILKQLSDRFSSSKYWYGDKWSI
    IDMYLFWNYTTAQSGGLDLNPYPSILRHSEAVQERPSVKKVIEQELLDLAKIHKGQP

    >gi|254295086|ref|YP_003061109.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
    MSLTLFAILTLWVVVLAIVVMMWVMLRQIGVLYERVSPVGALMDSSGPEVGAPSPLFSIQNLNGPDNVMIGAEGDKAKLV
    FFLSPT
    CPVCKQLLPVLAGIRSEEGDRVDVVFASDGDANKHREFIAKNRLKDYPYVLSADLGMGYRVQRLPFAVVIDAEG
    IVRAKGLVNNREQLESLFNALERGVPSVQELVAIREMEAVG

    >gi|254295327|ref|YP_003061350.1| HI0933 family protein [Hirschia baltica ATCC 49814]
    MSSENYDIIVLGAGAAGLFSAIEAGKRGRSVCVIDHAKKPAEKVRISGGGRCNFTNVNTHPSRFISQNPHFCKSALKQYT
    QHDFIARVDQQGIKYHEKTLGQLFCDDSATEIIQMLLDDCAANNVEIRLSTEIIGVSKRDTEFLVQTSIGNMHCESLIVA
    TGGLSIPKMGATPFAYELAKQFGLNIIDPRPGLVPFMFGGELLAEMSELSGVSVRARIDTGEIAFDEAMLFTHRGLSGPA
    ALQASSYWLPGNEIEVNLAQRVDALAALKKGREEAPKKKLASVLETFLPSRLAQSIAEQTYASFRMADLSNAKLEEIAKR
    ISAWRLKPVGTEGYRTAEVTIGGIDTNDLSSKTMEAKNVAGLFFIGEAVDVTGWLGGYNFQWAWSSGYVAGQNA

    >gi|254295357|ref|YP_003061380.1| hypothetical protein Hbal_3015 [Hirschia baltica ATCC 49814]
    MAKNNINPEDNIHLRKMKPALIFAVLSVCAAIAMFAFGHMSAQTSNSQRKPSAVDYPTFQAMTDEARSHREQRLITLENF
    LEMGAVSDTIILDTRSKSAFEDGHIKGAVHLNFSDFTDDKLAEIIPDFDTRILIY
    CNNNFSDDVAPVPKKMVSLALNIPT
    FINLYGYGYTNIYELGEEISLDDLGDNWITKSNH

    >gi|254295392|ref|YP_003061415.1| UBA/THIF-type NAD/FAD binding protein [Hirschia baltica ATCC 49814]
    MNLTSEQIQRYARHIMLREIGGPGQQKLLKSTVALVGAGGLGGPAALYLAAAGVGNIRLIDDDEVSLSNLQRQILFSTSE
    IGAPKVKSGKERLAALNPDCSITEISKRLNADNAAECIGGADFVLDGSDSFQTRFDVNQFCHDNNRTLISGAVGRWSGQV
    SVYKSGLTKANEKKDKLPCYRCLTPELPETEIS
    CAEIGVIGPLTGIVGARMAMETVKEITKAGQSMAGRLWIYDALSGDG
    RTIKLPIDPACPCCS

    >gi|254295494|ref|YP_003061517.1| arsenate reductase and related [Hirschia baltica ATCC 49814]
    MLTLTGLKACDTCRKAQKWLAENDIRFTYRDVKSDGVPQNDLERYVALLGWDKAINKASTTWRGLSDDQKNDITDEKAVN
    LLLANPSLMKRPLFEIGDEIVLGFRDEQKQRILELI

    >gi|254292736|ref|YP_003058759.1| hypothetical protein Hbal_0360 [Hirschia baltica ATCC 49814]
    MKLLKKYGFAVVMVLAICGFAAFNGMGFLSKTASESEYVYDGEPEIIAATFSSAWCSACKILEPKLAQVAPEFANKPVKF
    VKLDFSLGQGSGPAEIAAENNFSSVYEKYKGGTGFTLLLDADSGEIVDQLTVKLSADEMKQVLKNSIQQVS