Herpetosiphon aurantiacus ATCC 23779 uid58599

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159896558|ref|YP_001542805.1| thioredoxin [Herpetosiphon aurantiacus ATCC 23779]
    MTFSTPIHTNDQSFERVLNTGYPLMVVWSSKTDPQSQAFDKVLNLLAIQFEGRALIVKVNPEENPKLTKDYAISAIPSAV
    FIRQGEVQGRCVGGLSKEQLQPVLEALVNGQALGNLPNAASTPLTPAAAVAGGSTPLTLTDANFEQTIRSGQTVLVDFWA
    AW
    CGPCRAIAPSIESLAKEFAGRAVVAKLNVDENPRIAQRFNIQGIPALLVFKGGKVVEQVTGAQPLPALRQVLARHA

    >gi|159896643|ref|YP_001542890.1| methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
    MNDQSIKASVQAYYGEWAEQVQQEQPKTSCCSSHDISLSSTLYRDTTTADLPATAVNSTRGCGNPVVRAALQLGQVVLDL
    GSGGGLDVLLAAKQVGPSGFVYGVDMTDAMLDLARQNAHKAQIENVAFLKGDIEQLPLENEQVDVIISNCVINLAPDKGM
    ALREAYRVLKVGGYMAISDIVIDGSLADFPLPEASLRAAMNWAG
    CVAGAPTREQYQQFLAQAGFQAISFEVTHRYSFEDI
    GGKLPEELAGLSDLQGQQLAERFTSCLIRAHKQI

    >gi|159896786|ref|YP_001543033.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MTRRIALIVLALALASCGSYASDSSRQVSIRPTIVPSTPAPPATQDPLGIASEFIPLAKPAQIPADDQRSMGDPNAPVTI
    VEYSDFQ
    CPFCQRHHVSVFPELKAKYIDTGMVRYVFRNYIAVESHTSAPAAGVASFCAMDQNKFWEMYDMLFVRASEWGV
    DPNLAPTVMLKYAEELDLDTAAFAKCQADPEVLAKVNAETAEAVAAQATGTPAFFIGNYIIPGAYPLAGFDAAIALANQN
    Q

    >gi|159896937|ref|YP_001543184.1| rhodanese domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MSDYVNSEVLVSTDWVAEHLNDPNVRLVESDEDILLYEMGHIANAVKINWQDDLNDVRIRDYIDGDDFAALLSRFGISND
    TTIVFYGDKNNWWACYAYWVFQLLGHEKLKIMNGGRKKWIDEGRELTRVVPSFEPTNYVVGQPKPEIRAFRDDVLAHIGR
    PNPRQTAIELPAGHSLVDVRSPDEYTGKKLHMPEYPQEGAVRGGHIPGAVNVPWAKAVNDDGTFKSADEIRQLYGEVGVT
    PESDTVVY
    CRIGERSSLTWFVLHELLGYKNVRNYDGSWTEWGNVVGLPIHNPTTSK

    >gi|159896982|ref|YP_001543229.1| OsmC family protein [Herpetosiphon aurantiacus ATCC 23779]
    MAKYTVTIEWERQAATFSDGKYSRAHRWIFDGGQVVKGSSSPHVVPLPYSDEQAVDPEEAFIAALSSCHMLWFLSIVAEA
    GLVVEHYQDQASGKMGKNSTGKIAMTKVTLRPNIIWAEPAPSSEQIEQFHHQAHEQ
    CFIANSVLTQISIEPQP

    >gi|159897069|ref|YP_001543316.1| UBA/THIF-type NAD/FAD binding protein [Herpetosiphon aurantiacus ATCC 23779]
    MQMLSFEPIAPFVIGNQSRFHITIVGAGGTGSYIVQTVARLMAHANEKGSPKIDVTLVDGDTIEAKNIGRQLFAPAEIGR
    NKAQSLATRFNQALGLKIQAIPTMIDQYSLPHVDRYQWHQSAALDKRPYSIVVGAVDNAEARKVIHDGLAKYVFNLWIDS
    GNHEHGGQVLVGNCVAPHKLKGSFALEGMVQSLPAPSLMAPSLITPPEPLPESQQLD
    CATAMENNRQSLLINQQMASIVG
    QYLHQIIFTQRLTTFETIVDMSTLTMRSTPITVSNVAQCLGVTSAFLKGINA

    >gi|159897139|ref|YP_001543386.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MSNTPKPRQGRQRVREKRSLLPFYLMLGLVGIVGLTFVFIQALQTPVAPPSASIPIRPVINAAIGQTSEGYWYKGDPNAP
    IKVIEFADFE
    CPGCRQLEVDLANANFDAEYIETGKVQWIYREFPLRSIHKSAQYTAEVSRCAGDQGVYWPVHMALYDSQL
    QWTNLDNPNPLILDAAVKAGANLDKLEDCMDAETHTAAINASYDSAKSLGLDQTPTVFINDDRINFVGDFYTDLKLAIDA
    KLGVTP

    >gi|159897218|ref|YP_001543465.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MASERVIVIGAVAAGTSAAAKAKRTNPDLDICVYGREAHVSYSACGLPYLISGAVADYQALIARTPAQFARDGVTVKTEH
    EVIDLDVAAGRVTVRDLATNSTFHDHFDRLVLATGARVNCPPVRGIELQGVFRLRSMHDGLAIQTYISEQQPKHAVVVGA
    GYIGLEMAEALLDRGIGVTLVNRSKTVLSSLDHDMSSQIISRLEAAGVQLALGCGLEGLEGKHDRVTHVVAGGRDIPAEL
    VIIATGVQPNSELAQSCGAELGEHGAIKIDQLGRTSVDRVYAAGDCSTVDHRILNKPVYLPLGTTANKQGRTLGAYLAGH
    ERPFRGVVGTAVTKFADLHIAATGLSVEQALHHGYHVRSKIIHSTDHAGYYPNARPITVKLVADAADGTLLGGQIIGFDD
    VAKRVDVVAVALAGRMTVDEFAWQDLSYAPPFSSVWDPLLVAAQALAKG

    >gi|159897311|ref|YP_001543558.1| hypothetical protein Haur_0782 [Herpetosiphon aurantiacus ATCC 23779]
    MGKMTAVASNPMTDLWVLNETGERVGFESLWQEKPILIFFMRNIGCGICRQTLLNLRDYDQAFKDAGWQIVVLMMGNVEL
    VSRFRSMYNIPFPIYVDQSLQVYDYFEIVEGSWLQVLSPQVLIRQAKLLVGGMELLNGAGSMRRLGGAAAINRAGQIVYH
    HVANPIYRYPEWSSVLQTLQQTN

    >gi|159897491|ref|YP_001543738.1| OsmC family protein [Herpetosiphon aurantiacus ATCC 23779]
    MAVRSAEATWTGSLREGAGSVKTGSGAVEGSYSFPSRFEDGTGTNPEELIAAAHAGCFSMALTADLGRGGFEPKSVHTVA
    KVHIERGDAGFSITKIELHTEADVPNIDAAAFAEFAEKAKVN
    CPISKALAAVPTIELHATLK

    >gi|159897505|ref|YP_001543752.1| OsmC family protein [Herpetosiphon aurantiacus ATCC 23779]
    MQISVTQSQQLDLIFNNQPLSYPADLNPVQLQAAALVGCTAAVMERYAQTAELDLTGTTVVIRWSFGSDPRRIDRYELAV
    ALPASVSEARQAAVLRAAQHCTVHATLEYPPLIEIRLS

    >gi|159897570|ref|YP_001543817.1| hypothetical protein Haur_1041 [Herpetosiphon aurantiacus ATCC 23779]
    MANRLIHETSPYLLQHAENPVDWYAWGEEALQRAKQDDKPILLSVGYSACHWCHVMAHESFEDPATAAVMNELFVNIKVD
    REERPDIDSLYMAAVQAMTRHGGWPMTVFLTPDGAPFYGGTYFPPEPRHNMPSFQQVLHGVAEAYRDRREEVFQSAEQMR
    EHLEDILSFDLEQVKLSKSQLNVAAQRQMSQFDSRFGGYGGAPKFPQALIFGMVLRTWLRSEDQDALNQVTQTLQAMANG
    GMYDQLGGGFARYSVDAQWLVPHFEKMLYDNALLSQLYLETYQATHDPFYRRIAEESINYILRDMTSPDGGFYAAEDADS
    EGEEGKFYVWSLAEIQQLLSPEDAALAQLYWNIQPEGNFEGHAILYVPQDPSVVAKELSISEADLAQRIAVIRATLLAQR
    NTRIRPGRDEKILASWNGMMLRSLAFAANVLDNADYRAAAIRNAEFITSKLYQNGQLYRSYKDGQAKFKGYLEDYACVAD
    GMLALYEATFDLRWLQVAIELAESMTERFWDAQQRSFFDTASDHEQLITRPRDLYDNATPAGNSVAVDVLLRLATLLDRY
    EYRQYAETVLANLSGALLQLPGAFGRLLAAADFALAEPREVALIGDPADPAFKALLQATYRNYQPNKVVAACKPDDHAAQ
    QLIPLLAERPLLNQQATAYVCVRRACKLPTNDPNELIKQLG

    >gi|159898007|ref|YP_001544254.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MMSNSTRSAKGHRRNQPARSFKMFYLALGVIGILGIGFVLVQSLSKPASVSNTGPMPNQAGLNAPVGKTADNYWYKGQSD
    APVKVEIYADYE
    CPACRTLELELAQADFDGLYVETGKAQVIFREFPLKTIHKSAQLTAEIARCAGDQNLFWPIHNALFDS
    QTQWAQSLGPKTQIMAAVEQAGADRQKIESCVDAGTYTDVINTAYDAALERQLQQTPTVFVDGQQVNFETDFAKTLMAAV
    DAKLPANSSN

    >gi|159898166|ref|YP_001544413.1| rhodanese domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MINELSVQELQVWANQQTIFLIDVREPAEYATGHIKGSNLMPLSQLNNYRNQIPHDLPVVVVCRSGQRSSMAAQWLASNG
    WNNIYNTRGGMLAWSKAGLPEER

    >gi|159898167|ref|YP_001544414.1| beta-lactamase domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MFFQRLYHDGLAQASYLVGCQKTGEALVIDPHRDSAVYLNAAQAAGLRISAITETHIHADFVSGSRELAQITGAKLYLSA
    AGTAAWQYAFASSNPNVQLINDGDSWMVGNLKIEVLHTPGHTPEHVIFMLTDTPAGDEPMGIFTGDLLFAGDVGRPDLLE
    KAAGIQGTSEAGAKDLFKSLQRIASLPDFLQVWPGHGSGSACGKALGAVPQSTLGYEKKVNWAFKQQNEADFVAAVLDGQ
    PTPPPYFAAMKRINRDGPELRPQRLPALSLAEIKLDNRLVVDLRSANDFAQASIPGALSLTSGAMLNRWAGWFVPVASKV
    VLIGTAEAAKTAQTELSMIGIDQIEGYITPDMLTEWLKTNPSQSYQRVPAANLSEQLDQAFVLDVRTPEEYANGHGAKAV
    NIPLNELPKRLAEIPNDQPLIVH
    CQAGGRSPIAMSLLKPHFSQAMVEMSDGWNGWYQLKKERHV

    >gi|159898265|ref|YP_001544512.1| OsmC family protein [Herpetosiphon aurantiacus ATCC 23779]
    MALKTLYTTTMTATGGRTGQVTAPDGSLTLDLASPKELGGPGGATNPEQLFAAGYAACFHSALSLVAKHAKADPTDSSVT
    GTVSLGANAQGGYGLAVTLTIDLPKVERETALALVEKAHTV
    CPYSNATRGNIEVELIVK

    >gi|159898274|ref|YP_001544521.1| methionine sulfoxide reductase A [Herpetosiphon aurantiacus ATCC 23779]
    MTQQYALATLGGGCFWCLEAVFDDLQGIIRVESGYAGGHVANPTYEEICGKKTGHAEVVRLTYDPSVINFSQILDVFFTI
    HDPTTLNRQGYDVGPQYRSAIFYHDAEQKAVAEQTIAALNASGQWPDPIVTEVTPINNYYEAEDYHQEYFAHNPFQPYCM
    AVVSPKVQKFRKEFSKQRKS

    >gi|159898430|ref|YP_001544677.1| uncharacterized peroxidase-related enzyme [Herpetosiphon aurantiacus ATCC 23779]
    MPRLKPLAPNEVDPESLKVFEGFFAKRGNVPNMFRTFARRPEMMIAASNLMSAVLSTGTLDLRLKEMVVVRTSQLNECSY
    CLTSHSTILRNLGLLQENIDALQSPDDPRWTERERVALRYAEQVTLNAKGISDELWSSLREHFDEGEIVELTATTSLFSM
    FNRFNDALDMAITEPGWPEA

    >gi|159898435|ref|YP_001544682.1| rhodanese domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MELPLMVNVQQLKQQLQAGNDLVLLDVRTAAEFESVHIDGSLNVVLDQIEQQRQQLSESLKHPVVLVCRSGNRARQAAAL
    LQHVNLPNLHILEGGIQAWQAANEPVKQGRQRWALDRQVRGLAGSIVLASMLGSLLWPPLRWVAAFMGAGLTYSALTDSC
    AMGMLLSKLPYNRQTTCQPSFTPIQNEVA

    >gi|159898681|ref|YP_001544928.1| glutaredoxin [Herpetosiphon aurantiacus ATCC 23779]
    MSKHVVVYGRTSFCPDLARSQRFLAANNVAYTQINIDQDAEAGALVEGWVGHRSVPTIVIAEAGSNLPFEEPAPLPAGRQ
    ARSYDRGTVITEPSDEALTGFLKRNGLLS

    >gi|159898867|ref|YP_001545114.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MKIMIIGGVAAGMSAATRLRRLDEHAEIVVLERGEYVSYANCGLPYHIAGTIAEREKLLVASPEYLRQTFNLDLRLQHEV
    IAIDPQQKTVTIKTPQQPTPIQERYDKLLIAVGSQALQLPIPGSDLPQIHTVRTIPDVDQINQLLADGAGHAVVIGAGYI
    GLETIEALQQRGLTVELVELAKQVLPLFDHEMVSEVADLLQQHGVKLHLGASAQRFVPTNQQIAVHLSDGRQIKTDLVIM
    AVGVRPASQLAQTAGLTLGERGGIAVNQHLQTSDPAIYAAGDVIEVQDTVLQQPALIALAGPANRQGRIVAEHMLGRSSR
    YHSSQGTAIVKVHTTTCAMTGASEKSLQRAQRAYHKIYLHPNDHAGYYPDAQPMHLKLLFAPADGRILGAQIVGGAGVDK
    RIDVLATAIRAKMSVHDLTELELAYAPPYGSAKDPINMAGFLASNLLDGTVKFWYAEEYPAITEHALIVDVRNPDEYAAW
    HIPEAINLPLAELRTAIPSLKAQAEGRPIRLH
    CMVGMRSYIAYRILRQSGFTNVATLAGGALTLKAFGH

    >gi|159899117|ref|YP_001545364.1| hypothetical protein Haur_2598 [Herpetosiphon aurantiacus ATCC 23779]
    MADSLFDPERDPFADMRNALETAQRERKNILVELGGDWCVWCHRLEAFINAHPQLRYLRDIHYVKVKVLVGDEQQKNKTF
    LEHLPGFDGVPHIFIYNSRGQLLCSQDTSPLEEGESYNFGRVRDFLSRWSEWRLSPYDALATDELKRLVELHYFGEYANQ
    ITPSA

    >gi|159899213|ref|YP_001545460.1| iron-sulfur cluster assembly accessory protein [Herpetosiphon aurantiacus ATCC 23779]
    MSDVAVKPMTAIEIDPALVTVTASAANRLLSIKQEKELSDEYALRVFVAGGGCSGLQYGMSFDDQTNEGDTEFFASGLRV
    IVDPMSAQYIGGASIDYIDSLMGGGFKIDNPNATSSCGCGSSFKPKNGEASASGGSCGSGAGGCGCH

    >gi|159899216|ref|YP_001545463.1| rhodanese domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MYNNQSAEDIAARIAAGEDLYLLDVREPNEWEIASIAGSERKAMSQINDWWGELPKDREIVVFCHHGGRSAQVCQALATQ
    AGFTQLTNMTGGIDRWSVAVDSSIKRY

    >gi|159899243|ref|YP_001545490.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Herpetosiphon aurantiacus ATCC 23779]
    MTSESETSAKQGLSRKEWLWLGAGIVVAIIVIATVAILTSGGSKPQTVVGIDRPVPDMVLKTVDGGSFNPTEYKGKPIII
    NFWASW
    CEPCKEEMPALVRTAERYGDKIAVVGINLTDQDNDQEIRRFIQRYAVTYPIALDNERVAQQAFGIFNIPVTFFI
    DSEGIIRYTRINAITESEMDHVLSELLP

    >gi|159899568|ref|YP_001545815.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Herpetosiphon aurantiacus ATCC 23779]
    MDDLLVIGGGSAGITFAKFGASLGAKITVIEANKLGGDCTWTGCVPSKSLIHAAKIAHTTATAARYGISAQPSIDFAAVM
    GYVHSVQQQIYQHDDAPEVLRQAGARVIEGRARFYDDQTVEVNGELLRAKHFCIATGSHPKIPTIPGLAEAGYLTNEDVF
    LLEALPKRIVVLGGGPIGCELGQALFRLGAEVTIIQQGPRLLPKDDHAMGAALAQALKSEGLQLYLNTKTLKVELQAGAK
    QLTIQTANNQPQTIVADAILVAAGRTPNLHNLGLDAAGILYDPEQRIHVDHYLRTSNPRVFACGDVIGRYQFTHVAAQEA
    GLVLRNALFPGQSAMKYELVPWATFTDPEVGHVGLNEDQARAKYGSSLRVYELPWSANDRARTEDATQGFTKILAVGRKE
    QIVGVHIIGQGAGDMINAAVLAMGTGVSASKLGGLINVYPTRSQGLKMTAQRSFTRWLEKPWLQRALRWYFR

    >gi|159899669|ref|YP_001545916.1| thioredoxin [Herpetosiphon aurantiacus ATCC 23779]
    MQTVIDQPVQVSDASFETQVLQSDTPVIVDFWAPWCGHCRVIAPILAKLAQRYAGEIVVAKINTDEDVQYASRLGVRGLP
    TMVVFQHGQEVDRWIGAMSEAAFEQRVQQLLGR

    >gi|159899799|ref|YP_001546046.1| heavy metal translocating P-type ATPase [Herpetosiphon aurantiacus ATCC 23779]
    MSQQTISLPIRGMDCSSCALHIQTALGELSGVMQAQVLFSAEKALITFDDQLLEPNALVQTIEQAGYQVPQLQAAPPKST
    PASARLLLLFGAIVVVVLGFSVLGEQLGWLDLLIDWIPWPIGVALVFVAGYRIFWRVAQAAWRKTVLSHSLMSIGVIAAL
    AIGQWPTALLVVLFMSIGEYVEQFTSSQARRAVRELTALAPTLAQVERDGTEIQLPIEAVQVGDVVVVRPGDQIPVDGVV
    LRGAASINQATITGESMPIDAIEGTQVFAATLATAGSLRIQATAVGRDSTFGNVIKLVEEAESQKAEIQRIGDAFSDYYL
    PVVALIALLTFVIQRDPLATAAVLLVACSCSFALATPIAMLATIGAAAKQGILIKGGKYLEALAKTSVLLIDKTGTLTHG
    QPAVSQVVVHAATNEAEVLCWAAAAEQDSEHPLAKAIVRAARDRSIDLPHVREFKALAGSGVQAVVEGQTVVVGHQRLLG
    EHPLQAQANALEQQGQTVIWVLREQQVLGLIACADRLRADVAPAIAQLRRLGIDTIEILTGDNRAVAANIAEQLGISYQA
    ELLPADKLAIVRRYQAQGHHVVMIGDGVNDAPALAQAHVGIAMGVAGTAVALDAAHIALLRDDWSLIPQALALALRTMRI
    VKGNLGFTVAYNVIGLSLAALGILPPVLAAAAQSLPDLGIMVNSARLLRYKPKPSSLPQ

    >gi|159899801|ref|YP_001546048.1| ArsR family transcriptional regulator [Herpetosiphon aurantiacus ATCC 23779]
    MELSQKRQFKDALYEQFARISRALANPHRLELLDLLTQGERTVEDLANETALSIANASQHLQTLRAAQLVSVRREGLYAY
    YRLANASVQALWLSLRQVGESQLADVQAVVQHFLADRSQYQSISISDLYQRIEQQDVVLLDVRPSNEFAVAHLPQARSIP
    ITELSQRLAELAPDQPIVAY
    CRGPYCLFADEAVATLSQRGFEVYRLDGGIVEWQAHGFALAQETAK

    >gi|159899802|ref|YP_001546049.1| beta-lactamase domain-containing protein [Herpetosiphon aurantiacus ATCC 23779]
    MIQTIDVTTLQTWLSQGQSVSVLDVRPEADWQEWSIPQSVHAEAYHDLKAGQLAPALQNLNLPQNQPIVTVCGMGKMSLV
    AAEQLQARGYQVYSLAGGMQAWSLAWNSAQLPTLANGTEIIQIRRTGKGCLSYLIGSQGQALVIDASLDPAVYLQLAQAR
    GWQLQAVLDTHIHADHLSRSRQLAELSGATFYLPANQRNSGVYQPISANMQIQLGAATIQALATPGHTWESMSYLLDGSH
    LFSGDTLFLAAVGRPDLEAQAAEAQQRASALYQSLQTILALDPASIILPGHTSKPVAFDGVPIMASLAEVQTATPRLAQT
    EAEFVAGLTAVRPATPPNHQTIVQLNQAGAALPDDLITLEAGANRCAIA

    >gi|159899804|ref|YP_001546051.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MNKSVATKKRQARTRKPQGGLPREVKMLLWLSVPVLLIVAVVMLTKAGAEPAQTVDVSRLIYPDSPVLGKTDAPVTIVEF
    LDPE
    CESCRAFFPIVKDVLAQNGDNVRLVVRYFPLHNNSVLAIAATEAAGNQGKYWEMQELLFNKQSEWGEKQTPQTALM
    LQYAQELGLDGDQFAKDLSDPKIMQKIERDNADAQALNVRGTPSFFVNGKEVSSLSQAALQSAIDDAK

    >gi|159899805|ref|YP_001546052.1| disulphide bond formation protein DsbB [Herpetosiphon aurantiacus ATCC 23779]
    MQPSAIESSALSEPDEHITISFGQRVRENLGYLAWLQAVVATLGSLYFSEIKGFPPCNLCWYQRILMYPLVLILTVGIIR
    RDPAMRWYGLPLSIGGWLVASYHCLLTYGVISAELAPCSAGVS
    CLARWINWYGFITIPLLAWVAFSVITVALLFAKPAKE
    LDHE

    >gi|159899911|ref|YP_001546158.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Herpetosiphon aurantiacus ATCC 23779]
    MDSTTLKVGDQAPDWTLTGTEGDVHLASFQGQKNVVLLFYPLDFSPVCSLQLPSYQARKPEFDQRDTEIFGISTDSKWSH
    KAFSEQLGLEYQLLSDYQRHVSEAYGVLRPEGFTNRAVFVIDKAGIIRHVSVTNPGQQPDQNEVIRVLETL

    >gi|159899946|ref|YP_001546193.1| electron transport protein SCO1/SenC [Herpetosiphon aurantiacus ATCC 23779]
    MKYAHWLFGCVLLGLVLSLSSCGTASYQIIRPIDNPTAAPDFTLIDQHGADFHLAEQRGKIVILFFGFTACPDVCPLALG
    LSSQARKKLADDADKIQIAFVTVDPERDNPATIDRYVSLFDSTILGLNGETEVVEAVKKAYGVHAERRELPDSALQYTID
    HTAGLYIIDQQGRWFAMANHDVDPTLLATDLETMLQYIDVE

    >gi|159899968|ref|YP_001546215.1| DSBA oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MSVSVDVWSDFVCPFCFLVSTNLKRLAETHDIQLTWHAFELRPFGSPPPDAQYRQFIAEKTPAMVAMAKTQYGVDINQGP
    FGIDSRWAHRAAKWAEQQGQGDAFAQAVLSAYWLQAQDISQPAVLAACAEVVGLDASNLAAILADPLYDAAVEEDIALAQ
    QLRLSGVPASVFAKRYLVVGAQPYEVFADVLQQANEPPASN

    >gi|159900120|ref|YP_001546367.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Herpetosiphon aurantiacus ATCC 23779]
    MIGRLASFGCIFLLLAACASQASPTAQSLPAANVSLAQNLSLAEGTVQIGEQIPELSYEQAGKKVALSDFRGKVVVLNFW
    QTT
    CVPCRTEMPDFEAIARERQDVVFIGVNKDENAEVVQRFASEIGVSYVLPLDRDGSISQAFNVNYLPTTYFIDPNGLV
    QKIHVGAISRSQTLKLISDFGQP

    >gi|159900271|ref|YP_001546518.1| methylated-DNA--protein-cysteine methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
    MQQLTIEQIATPIGAVVIISSPQGVVYLDFGDNQARCQRLLSQRYGQFALIPASQNLWADAVASYFAGDLRALDVITVDL
    AGSEFQCKVWLALREIGVGQTMSYGELAAKVGTPSAARAVGMTNGQNPISLVLP
    CHRVIGANKSLTGYAGGLERKRWLLR
    HEGAQFKDTPAQASFELV

    >gi|159900309|ref|YP_001546556.1| peptide methionine sulfoxide reductase [Herpetosiphon aurantiacus ATCC 23779]
    MIERIIVGAGCFWGVEAAFGALAGIVQTQAGYAGGWTEQPSYEDVCAGSTGHAEVVELHVDLTIISLNELLGYFWAMLEP
    PADPDPQYRAMIICSNAAQLELALASKLAQPQLVDYSVEIKLDLPFYPAEEYHQQCYRKWRDRFERRAKVV

    >gi|159900310|ref|YP_001546557.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Herpetosiphon aurantiacus ATCC 23779]
    MFDVIIVGGSVAGLSAALVLGRARRSVLVLDSQQPRNAQSPGVHNFLSRDGILPAELRQIGREQLKPYPSVQVRFATAEH
    AQAIDGGFVVKLDDGSEISSHKLLLASGVIDELPPIEGLAELWGSSVFH
    CPYCHGWEVRDQPLAVLVPDAERLFHVATLL
    HNWSSDLVVCTNGEAQLSPEQRQILAKLNLPIREDRLVGIEQANGQLTHLIFDQGEPLARSGLLIGVPQRQRSQLPAQLG
    CEVSDNPHMPGLIKVQMLGQTSVPGVYAAGDATAGMQQAINAAAGGAMAGAGINHELIQDMLKQL

    >gi|159900332|ref|YP_001546579.1| thioredoxin reductase [Herpetosiphon aurantiacus ATCC 23779]
    MEKQKVTVIGSGPAGLTAALYAARANLTPLVIRGIQPGGLIATTSEVENYPGFPDAINGFDLADKMEKQAARFGTHFLDG
    IVEKVELGERPFKLHIDNGTIVETETLIIATGASPRKLGVPGELELANRGVSY
    CAVCDGFFFRDKTLVVVGGGNSALDES
    LFLTRYAKEVHIIHRRDQLRADPVLIERAQNNPKIKFIWDTVVTKVEGTVKVEGVALHNVKTGEESTFAADGVFPYIGHI
    PNTWLFKDQIELDENGYIVSPGRARTNVPGVFVAGDVEDHVYRQAITAAGSGCMAAMEASWFLDQIEHEQTSLAQW

    >gi|159900839|ref|YP_001547086.1| copper-translocating P-type ATPase [Herpetosiphon aurantiacus ATCC 23779]
    MDTKTLTLPVTGMTCAACVTRVERNLKKVAGVAEASVNLASESATVAFDPAAVSPTNLIAAVEKGGYGVITAERTLPITG
    MT
    CAACVTRVEKALRKVDGVLEATVNLATETASIRYLPDQASLEQIKAAVTKAGYGVIETGEDDDAEDSETQARQAELKR
    KRSNLIVALILGVPLMIVSMMHDFSLISPIWLGSAREMTGMNHDMPAFYNLWPWLFGLMATPVVFYSGRDFLRGAWVNLK
    HGSANMDTLIALGSLTAYGFSLAVLLFKLSGHVYFETAAMIVALILVGKYLEAQAKSATSSAIRALIDLQPPTARVLRGG
    VEVEMPVAEVRAGEIVVVRPGEKIPVDGVVTMGQSAIDESMLTGESLPVEKRVGDSVFGATLNNAGSFQLRATAVGKASA
    LAQIVNLVKAAQGSKAPIQRLADQISGVFVPIVIVIALLTFGLWYWVGGVGFTQSLIFAVAVLVIACPCALGLATPTAIM
    VGTGVGAQHGILIKNAESLERAVRLQTIVLDKTGTITEGKPTLTNVLALGDEANLLALAATAERGSEHPLGKAIVQGATA
    RGATLGQASTFKAIVGGGIEAEVNQQKVVIGSPRLIREQGYDLSNIQTTIDQWQSEGKTAMVVVVEQQLAGVLAVADTIK
    ASSPAAIQQLRKLGLKVVMLTGDNQRTAEAIGREAGVEQVIADVLPADKAATIKQLQANGTLVAMVGDGVNDAPALAQAD
    VGVAIGTGTDVAIEASDITLLRGDLVGVAQAIELSRRTMTTIRWNLFWAFIYNVIGIPIAAGLFYNLTGWQLSPLLAAGA
    MAFSSVFVVTNSLRLKRAAKLQHGHGVESNELQPAHI

    >gi|159900920|ref|YP_001547167.1| thioredoxin [Herpetosiphon aurantiacus ATCC 23779]
    MAKPLAVSDAEFESAVINSDIPVLVDFWAPWCGPCRSIAPVLEELADEYQGKLLIAKVNTDEDSGNAMKFGVQGIPTLIF
    FQGGQEVDRIVGAGPKKIYQERIEAILNPVTEA

    >gi|159901026|ref|YP_001547273.1| dihydrolipoamide dehydrogenase [Herpetosiphon aurantiacus ATCC 23779]
    MAQYDVVIIGSGPGGEVAALRAVQLGLKVAVVEKEQVGGVCLNIGCIPTKSLLHCADLLEETKEGKKFGVITGEVSFDLK
    GAMGHKEKVVKTMRTGLEGLFKKKKIDLFRGFGRLAGTNKVAVKGNDGTETVIETKNVILAVGSTPRALPFAPFDEQRIV
    SSTGALSLPEVPKHLVVIGGGIIGCEFASMYRTFGSQVSIIEMLPRIVATEDEEISAELAKAFTKRGIKLYTGSKTKAVN
    KRADGASVVFEGPDGKEQTLEADYVLIGTGRAPLTKNIGLEEVGVTIDERGYIPVNATMQTNIANIYAIGDVVPTPWLAH
    VASAEGVIAVEHIAGHHTNPINYDIIPSCVYCSPEVAHVGLTEAQAKERGYNVKVGKFPFAAVGKATAIGNRDGFVKIVA
    DAEYGEILGFHMIGPRVTELVAEGGLALSHEATVESLLATIHAHPTLYEAMHEAGHALLDGTLHL

    >gi|159901119|ref|YP_001547366.1| methylated-DNA--protein-cysteine methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
    MPVEYCIQTSPFGRLLLAAASEGLLLASFADDDSELLAELTEAYPERLLLYRSNTLLDQAFYQYQAYFSGQRQQFALPIA
    WHGSAQQQAIWQQIIQIPFGQQWSYQQLAQTLPTPYQAAHAINQALRHNPLALIIP
    CHRLSNSPQGLGYYRWGRVRQQQL
    CDREASPVIATYSMEMMS

    >gi|159901222|ref|YP_001547469.1| peroxiredoxin [Herpetosiphon aurantiacus ATCC 23779]
    MTTLNVGDLAPEFELPADNGETIRLSDFRGKRVVLYFYPKDDTPGCTTQACGFRDAYPQIEEQNAVVIGVSPDSVASHQK
    FKTKFDLPFLLVADEQHSLAEAYGVWGEKSMYGKKYMGVTRSHFIIDENGYLIDVQGKISPADSVSGALKLLIK

    >gi|159901234|ref|YP_001547481.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Herpetosiphon aurantiacus ATCC 23779]
    MTTATAGKLAVGDQAPTFSLPNQTGQLVDLQSLLGHKKIVLFFYPKDHSAGCVAEVCAFRDQYEVFKQAGAEVIGISSDS
    VESHEKFAANNRLPFTLLSDRDGTVRKLYGATTLGILAGRVTYIIDHHGTIQHIFSSLLNANKHISEALRIIKEA

    >gi|159901235|ref|YP_001547482.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Herpetosiphon aurantiacus ATCC 23779]
    MTTTTTGKLQVGDQAPRFRLPNQTGALIDLDDLLGKKHIVLFFYPKDDSLICVAEVCAFRDQYEVFKQAGAEVIGVSSDS
    VESHQQFAAKHRLPFTLLSDGDSAVRKAYGATTLGIFSGRVTYIIDPQGTIQHIFSSRLNAQKHIDESLRILQQA

    >gi|159901388|ref|YP_001547635.1| UBA/THIF-type NAD/FAD binding protein [Herpetosiphon aurantiacus ATCC 23779]
    MPSSGIPSARYSRQTRFAGLGQAGQQRLAQARVAIVGLGATGSTIAHALLRAGVGYLRLIDRDWVEEHNLPRQSLYTEAD
    AAQLVPKVVAAKAHAQRINSACDIEALVLDLHAGTIDQALAGVDLIMDGSDSLETRLLINQWCVREGKPWIYSGVLGGHG
    MTANFRPKQACWRCVFTTSPEPGSMPT
    CETAGVIGPVVGVIGNLAATEALKLLSGQGQANPDLYMLDLWAWQFEQLPLPT
    PRPDCPVCGLRQFDLLEQDSAPTLSLCGRNAIQIRPQQPITMALAQLAAHLQQADLRVIQTDYLLRFAAETLQATVFPDG
    RVIISGTDDPALARGFYNRWINH

    >gi|159901409|ref|YP_001547656.1| hypothetical protein Haur_4898 [Herpetosiphon aurantiacus ATCC 23779]
    MDTALPLIAIRDIYNQSLPFGSLWRDQAALLVFLRHPGCAVCRRNLLDLYEYTTAFRMLDINLAVITMAEPAAAQAFARL
    YRLPIPIYSDPERQIYRAAGFSEGSLYSVASPQVMLHQAWQFLQGHWVGGGQGQSLTQHGGHALIKCRATAPSYIHVADP
    IYRYPAWQSVLEYTQQRFYTTEDINPSFARQLA

    >gi|159901687|ref|YP_001547933.1| hypothetical protein Haur_5178 [Herpetosiphon aurantiacus ATCC 23779]
    MRSPDPTTGEPIRLYGHDRCPAVPPVRGLLNRASIPYVYINIHHDPAAAAVVQQINDGNESVPTLVFPDASTLTEPTTTQ
    LVTRLAQVGYAVPWHAQLIGHSWKLLIVAGILLAIVRGLGWI