Herminiimonas arsenicoxydans uid58291

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|134093318|ref|YP_001098393.1| Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein) [Herminiimonas arsenicoxydans]
    MLDANLKTQLAAYLEKIVQPIEIVASLDGSDKSRELQELLQEIVVLTDKITLVERTDDDERKPSFIIKRPDAHAGIQFAA
    IPLGHEFTSLVLALLQTGGHPLKLEDSVIEQIRNLDGDYTFETYMSLS
    CHNCPEVVQAFNVMALINPRIRAVTIDGGLFQ
    DEVKERDIMAVPTTFLNGQPFESGRVSIEQILAKLDTGGNKRKQEELSAKAPYDVLIVGGGPAGAAAAIYAARKGIRTGV
    VAERFGGQVLDTLSIENFVSVQETDGPKFAVALEQHVRSYDVDIMNVQQASELVPGKLIEIKLKDGGSLKGKTVILATGA
    RWRTIDVPGENEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTLIEFGAELRADAVLQRKLRSMP
    NVTVITSAQTTEITGDGKRVNGLVYKDRKTEEVKTVELEGVFIQIGLVPNTEWLKGTVALSRHGEIEVDARGQTSVPGVF
    AAGDVTTVPYKQIVIAVGEGSKAALSAFDHLIRTPDTDEEVVAIQGEAIPA

    >gi|134093319|ref|YP_001098394.1| alkyl hydroperoxide reductase subunit C [Herminiimonas arsenicoxydans]
    MSLINTQVQPFKAQAFHNGKFIEVTEQSLKGKWSVLIFMPAAFTFNCPTEVEDAADSYAEFQKLGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLVGDPTHALTNAFGVHIPEAGLALRGTFVINPEGVIKTMEVHDNAIARDVSETLRKLKAAKYVAE
    HPNEVCPAKWKEGEKTIAPSLDLVGKI

    >gi|134093385|ref|YP_001098460.1| Thiol:disulfide interchange protein dsbA precursor [Herminiimonas arsenicoxydans]
    MRFIQHLLAVATLGLMAATAGASPAAPINGTDYRTLEKAQQTDSGKKVEVTEFFWYSCPHCEALEPTLQAWVKKNADKIV
    FKRVPVAFRASFIPQQKLYYTIEALGMVDTLHARVFRAIHIERQQLDTDKQILDFIAKQGVDAKKFADTYNSFGVQTKVQ
    RAAQLQEAYKVDGVPMIAIDGRYVTSPSIVGAALGNRPEAVLHDATLQVMDHLVAKAAK

    >gi|134093401|ref|YP_001098476.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguani
    MISYIEHPSPVGILLIAATDAGICGIYFEEHKHFKGKDGWLQTPTQSALRHLKNAAMQLDEYFAAKRTRFDVALDLSGTA
    FQREVWSALNAIPFGQSVSYAQHAQGLGNPKALRAVGSAIGKNPVSIIVP
    CHRVIGSAGAVTGYAGGVERKRFLLALESV
    AVK

    >gi|134093470|ref|YP_001098545.1| putative thioredoxin [Herminiimonas arsenicoxydans]
    MQTSVPATQKRNWLKIVILLIIVALAVVGYLSVSKKEAIPEVTFVNLQGQKITSQDLRGKVVMINFWATSCTTCVKEMPE
    MVETFNKYNAHGLEFIAVAMAYDPPNYVLNFVETRKLPFTVALDTQGELAKSFGNIQLTPTTLVIDKNGHVIKKYVGEPD
    FAALHQLLEKALAV

    >gi|134093472|ref|YP_001098547.1| putative disulfide bond formation protein DsbB [Herminiimonas arsenicoxydans]
    MKNSRPVLFAVALASLLLLAVALYLQHVENMLPCPLCVIQRYAFAAIALICLVTAFRTEVTARIGAALAALASLAGAGVA
    GWHIYIKAHPTVS
    CGIDPLETSLNTIPTAKLLPFLLQADGLCTTEYAPIMGLSIPQWALVWFIVIALFLLHTAFRKKS

    >gi|134093483|ref|YP_001098558.1| putative thioredoxin-like or protein-disulfide isomerase [Herminiimonas arsenicoxydans]
    MNIFKAAIAVVLGLTFTAAFAETAQEAAVRKAIEPRLGSDAKVASVTKTPYSGLFEVQVNGDIIYTDVKAQYLFVGRVVD
    TKTYQDYTKARLDELNQVAFSDLPLEAAMKQVKGNGKRVIAVFEDPN
    CGYCKQFRKTLEGINDITVYTFMYNILSPDSIT
    KSRNVWCSANRNKAWDDWMLNGKAPASASDNCVTPHEKVLALGRSMKVTGTPTIIFTDGSRVPGAIDAKALEAKLLSLK

    >gi|134093528|ref|YP_001098603.1| iron-sulfur cluster insertion protein ErpA [Herminiimonas arsenicoxydans]
    MNAIAEMPSPILFSDSAAAKVAELIEDEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNEDDTTMTKNGVQLLIDSMSYQY
    LVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSFTA

    >gi|134093554|ref|YP_001098629.1| putative 3-mercaptopyruvate sulfurtransferase [Herminiimonas arsenicoxydans]
    MAYTTLISAADLAEHVFASNWVVLDCRHDLANPDFGRQAFAEGHIPNAQFATLDTDLAGEKFGADKAFRGRHPLPDRTKF
    IATLRRWGIDDDTQVVAYDAHGGMFAARLWWMLKWVGHDAVAVLDGGLPAWLAQGMFVSTETTSRMLGTLTDQASLVAVV
    GVDDVLKNLTACTRTVVDARAADRFRGENETIDPVGGHIPGAKNRFFKENLQADGRFKSADQLRSEFSELIGNPEQAIMQ
    CGSGVTACHNLLALEVAGLPGAALYPGSWSEWCADPSRPVAQTV

    >gi|134093568|ref|YP_001098643.1| peroxiredoxin HYR1 (hydrogen peroxide resistance protein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase
    MNTQTVYDFSSHSLSGAAVDLAQYRGKVLLIVNTASKCGFTPQYEGLEAVYRQFRERGVEVLGFPCNQFGGQEPGDAAAI
    GTFCEKNYGVTFPLFAKIDVNGDNADPLYQYLKHAAPGLLGSEAIKWNFTKFLIRKNGTVYKRYAPQTKPEELIEDINTL
    LAE

    >gi|134093691|ref|YP_001098766.1| putative methylated-DNA-[protein]-cysteine S-methyltransferase [Herminiimonas arsenicoxydans]
    MRLFCFMLCICINVFRLHAMKQTSSSSLFSAIVEASFGAIGIRTEDRVVRELVYLPASFHGKDAIDPVAQKAAVQVERYL
    SDPDFHFDLPLAPIGTPFQQKVWAAIGEIPRGKVLTYGDIARRVQSAPRAVGQACGANWFPLVIP
    CHRVTAATGLGGFSH
    HDDETGFHVGVKRWLLAHEKVAGY

    >gi|134093725|ref|YP_001098800.1| hypothetical protein HEAR0455 [Herminiimonas arsenicoxydans]
    MSACCCLSGPASANNIVLFARAITIKKRTNMLSTPSFVNIAAYKFISFDDTVEKRPEFIAKCAQLSLKGTILLSPEGINL
    FLAGTRADIDSFLAWIRADVRFSDLEVKESYSDDQPFKYMLVKLKREIITMKHPLIKPEEGRAPSVDATTLKRWLDQGHD
    DDGKPVVMMDTRNAFEVDVGTFDNTIDYRIEKFSEFPDIVASNKDDLNDKTVVTF
    CTGGIRCEKAAIYMKNVGYDSVYQL
    DGGILKYFEEVGGDHYTGDCFVFDHRTALNPRLEPTLTTTCTACNATVSPREQLAPEFVEGVSCPHCITQAASH

    >gi|134093764|ref|YP_001098839.1| arsenate reductase [Herminiimonas arsenicoxydans]
    MTTIYHNPACGTSRNTLALIRNTGEEPTVIEYLKTPPSRVILIQMISDAGLSVREAIRQKGTPYAELGLDNPQLSDDALI
    EAMLANPILINRPFVVADKGTRLCRPSELVLDVLSKPQQQEFTKEDGEAVINAEGQRVTKFS

    >gi|134093781|ref|YP_001098856.1| putative metal-transporting P-type ATPase [Herminiimonas arsenicoxydans]
    MAEIHRPQSKQDIADCCSIGDCQSLSNTATQPASSDVPSNAQSVQYRISNMDCPVEEKLIRNKLEGMNGVVRLDFNLMNR
    ILNVHHRLKSLESVTTALKAIGMDAQLVDSEAHQPNVQESASLTAAQKILLAVSGVAALAAEVLAWTTHSDGSPLVIALA
    FISIATGGLPTLKKGWIALKTFTLNINFLMSLAVIGAMAIGQWPEAAMVVFLFAVAELIESLSLNRARNAVHGLLKLAPD
    VVSLQDANGGWQEKPVESAVVGDMMRVKPGERIALDGVVTSGESSVNQAPITGESMPVDKRMGDSVYAGSINERGLLDIK
    VSTSSGNSTLAKIVRVIEETQNNKAATQRFVDTFARYYTPAVVVMAILVAVIPPLIFGAEFTPWLYKALVMLVIACPCAL
    VISTPVTVVSGLTAAARLGILIKGGEFLEVGYKLKAIALDKTGTLTAGQPSVVDVKTVGNSNRESILLLAASLDVNSDHP
    LANAIVKAGPESSQHKVVANFEALPGRGVKGEIDGTIYYLGNHRLIEELKVCSPAIEALLDEIEGAAQTAVMLATDKTVV
    GIIAVADSLRESAIEGVRQLNQLGITTVMLTGDNNRTAQQIGAQVGINVIKAELLPEDKLTEIKSLQSSYGVVGMLGDGI
    NDAPALAQANVGFAMGAAGSDTAIETADVALMNDDLRKLPAFIKLSRATRSILIQNITAAIGIKAVFFILAFMGIATLWM
    AVFADVGASLLVVFNGLRLLRK

    >gi|134093797|ref|YP_001098872.1| putative metal binding carrier protein [Herminiimonas arsenicoxydans]
    MKTKLFKVMGMTCRSCVARVSAAMTKVDGVDKVSVSLAAGEATVSFDESLTTEEELQEVLRNAGYGVTSEQDAKPKASGC
    CCA

    >gi|134093952|ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans]
    MSENITHITDASFDTDVLKSDTPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIRIAKMDVDANQAIPAKFGIRGIPTLI
    LFKNGVPAAQKVGALAKGQLTAFIDSNI

    >gi|134093989|ref|YP_001099064.1| putative glutaredoxin [Herminiimonas arsenicoxydans]
    MKKGLLPLSLLITLLVSANVHAQLYKWVAPDGKITYSDTPPPSSVKKVEEKALATGPSTVGFPFELAQAVKSSPVTLYTT
    SK
    CEACTDARNLLNTRGVPYTEKTVNSNDDIARLKQAGGDRQLPFATIGSQKQSGFNSELWDTALTSAGYPASSQLPKSY
    RNPAPEPAAPKPKSVETRAADNKPAAPLTDTLPAGGNAPPGFRF

    >gi|134093994|ref|YP_001099069.1| dihydrolipoyl dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes) (dihydrolipoamide
    MSTIEVKVPDIGDFKEVEIIEMLVNVGDTIKVDQSLITVESDKASMEIPSSHAGVVKELKVKLGDKVAEGSLLLILEASE
    SAAAPAAAPAAPAPAAVAPTPEPAAAPAAASVKAAAPVSAPAAAPVNAPAAASFAGKADIECDMMVLGAGPGGYSAAFRS
    ADLGMATVLIERYSTLGGV
    CLNVGCIPSKALLHVAAVIDEAAAMTAHGVTFGKPQIDIDQLRGYKEKVIGKMTTGLSGMA
    KARKVNVVQGVGQFVGTNHIEVTAADGSKKTIQFKQAIIAAGSSVVNLPFIPEDPRIIDSTGALELRSVPKRMLVIGGGI
    IGLEMATVYSTLGARIDVVEMLDGLMQGADRDMVKVWQKFNEKRFDKIMLKTKTVAVEALKEGIKVSFEAAEAGVTAPEP
    QVYDMVLVAVGRSPNGKKIAADKAGVAVTDRGFIEVDAQMRTNVHHIFAIGDLVGQPMLAHKAVHEAHVAAEAAAGEKSY
    FDARVIPSVAYTDPEVAWVGITEDEAKAKGIKLEKGHFPWAASGRAVANGRDEGFTKLLFDAETKRIVGGGIVGTHAGDM
    IGEIALAIEMGADAVDIGKTIHPHPTLGESIGMAAEVYKGVCTDLPPMKKK

    >gi|134094020|ref|YP_001099095.1| hypothetical protein HEAR0775 [Herminiimonas arsenicoxydans]
    MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCDTRNIPTENIRLSQNNIVDPE
    NRYQQIFKIQVELPPDIPDADRRGILRSIERCTVKKVVQAGPEFVIEEVENLDADAQALLTLNPATDASTYIAGKDLPLE
    QTIANMSGVLADLGIKIEIASWRNIIPNVWSLHIRDAHSPMCFTNGKGATKESALASALGEYIERISCNHFYAGSFWGVD
    IANAAFVHYPNERWFKPGHKDALPADILDDYCLEIYNPDGELRGSHLIDTNSGNVQRGICSLPYVRQSDGEVVYFPSNLV
    ENLYVSNGMSAGNTLVEAQVQCLSEIFERAVKREILEGEIALPDVPQEVLAKYPGILAGIQGLEEQGFPVLVKDASLGGV
    YPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPRPTFASEAVTEPYNFVEHFIDSSGIVSWRF
    FSAKADYDFVEWDFSGQGENSNAEEAATLFGILEDLGKEVYTAVYDQLGAIACRILVPGYSEIYPIEDLIWDNTNKALLF
    RTDILNLHDLDDASLEALLERLDNSELDEYSDIATLIGIKFDENTDWGQLTVLELKLLIHLALQQFEAAHELVGAFLQYN
    DNTVERRLFYQAMNVVLEVLLDDDLELDDYVVNFRRMFGNERMDAVMGSVDGSVRFFGLTPTSMELEGFDRHHRLIDSYK
    KLHKARGNVKATAG

    >gi|134094069|ref|YP_001099144.1| selenide, water dikinase (selenophosphate synthase) [Herminiimonas arsenicoxydans]
    MTTETPPIIRLTEFSHGGGCGCKIAPGVLSQILKSTGGFPLPKELLVGIETSDDAAVYRLNDEQALIATTDFFMPIVDDP
    YDFGRIAATNAISDVYAMGGTPIMALALVGMPVGKLPLETIGLILKGGEAICAEAGIPIAGGHTIDSVEPIYGLVVMGLV
    HPSHIKRNASARAGDQLILGKPIGVGVLSAALKKNLLDAAGYASMIANTTKLNTPGKALAQLAGVHALTDVTGFGVLGHL
    LELARGAGLSAQLDMSLIPLLPQVRQLAELGCITGASGRNWQGYGHEVTLAPSISPLQQALLTDPQTAGGLLVSCAPDAV
    EQVLQLFRKDGFAEAAVIGEMRAGKPGVEVR

    >gi|134094151|ref|YP_001099226.1| hypothetical protein HEAR0915 [Herminiimonas arsenicoxydans]
    MTIDWVHFTPWISLVGGLLIGVSATLFLFFNGRIVGISGIVGGLFRPSNGDIGWRLAFIAGMVCAPFVYGLAFPLPVVRV
    DTSTPVLIIAGLLVGIGTRYGSG
    CTSGHGICGLSRRSPRSMVATLAFMFAGFVTVYLVRHAFT

    >gi|134094251|ref|YP_001099326.1| thioredoxin reductase, FAD/NAD(P)-binding [Herminiimonas arsenicoxydans]
    MPSPKHAHVLILGSGPAGYSAAVYAARANLKPVLITGVEQGGQLMTTTDVENWPGDPLGVQGPELMQRLLQHAERFNTEI
    IFDHIHTTKLDEKPIRLIGDMGEYTCDSLIIATGASAQYLGLPSEQAYMGKGVSA
    CATCDGFFYREQEVAVIGGGNTAVE
    EALYLSNIATKVTLVHRRDKFRAEAILIDRLMAKVAEGKIEIKYNHTLDEITGDDSGVTGINIRSTTDDSITAIKLHGVF
    IAIGHKPNTSIFEGQLDMHNGYIKTKTGLEGMATSTSVPGVFAAGDVQDHIYRQAVTSAGTGCMAALDAQRYLESQE

    >gi|134094426|ref|YP_001099501.1| putative thioredoxin SoxW [Herminiimonas arsenicoxydans]
    MHKLLQSFCLIVCILSGTGLMAGHAQGAETKLGVVPPLADLGRDGERARLEKKPLILFFSMPDCSYCKVVRQNYLAPLLR
    NHVVKNRPLIREVDMTSLKEVKDFDRSLTTQRDVAKRFNVHAAPTVLFMDAHGELLTAPIVGGDIAGLYGGYLDNAFAES
    ASKLAEKPDNKKGQHP

    >gi|134094547|ref|YP_001099622.1| hypothetical protein HEAR1322 [Herminiimonas arsenicoxydans]
    MTINLYGIPNCDTVKKARTWLSSNGTDFVFHDFKKDGITRELIATWLRDVPWDVLVNRKGTTWRKLPDERKAAIVDAASA
    TELMLESPSVIKRPVLVRNKKTTVGFSADLYQHIFQD

    >gi|134094671|ref|YP_001099746.1| hypothetical protein HEAR1448 [Herminiimonas arsenicoxydans]
    MGFLLELIEQYGLLFVFANVLLEQLGAPIPAYPTLVITGALLGRGEYSAPMLLFVAVLAALIADFAWYLAGRRYGARVMA
    RLCRISLSPDSCVRQTESIYLRFGPASLLVAKFIPGFASVASALAGAIGTRSVKFIFFDALGAALWSGSAIFLGSLFSSA
    VSDLLDILASLGKWGLVLVAVALAIYIARKWWQRHSFLKDLRMARISVDELDQLLKQGNPPTIIDVRSDFAQQGGRIPGA
    MVLSDEDISALVINTETDSEVIVY
    CACPNEVSAARIARKLMQRGYTRVRPLTGGIEAWVAAGFSVDRH

    >gi|134094759|ref|YP_001099834.1| putative toxic metal efflux pump [Herminiimonas arsenicoxydans]
    MSNCCSKECSVTSNAVDVENNDTELKGTQTLFRIENMDCPTEEGLIRNSLQKIEGVTALDFNLMQRKLTVTHALTSTAPL
    VAALSSIGMQAQELSARRTTLLISKMD
    CPTEEGLIRKKLHGMASIEDLQFNLMQRTLTFTHAPEALAPVLVALQEIGLGA
    ETQESTQDGAKSQPTSNASWLPLALSGITALSAEVVHWYNGGNNWMVITLALGAILLGGLDTYKKGWIAVRHGNLNMNAL
    MTIAVTGALAIGQWPEAAMVMFLFALAELIEQKSLDRARNAIRGLMDMTPETATVRQADGSWADIEAKTIALGAIIRVRP
    GERIALDGKLINGQSTINQAPITGESVPVEKSIGDTVFAGTINDAGSFEFEVTARSESTTLARIIHAVEEAQGSRAPTQR
    FVDQFAKIYTPAVFVVAVLVALVPPLAFGQPWYDWIYKALVLLVVACPCALVISTPVTIVSGLAAAARKGILIKGGVYLE
    QGRKLSWLALDKTGTLTLGKPSVTDYLPSAVSQSNTLEIATSLAGRSDHPVSRAISVYGDAHITARNEVDNFRALLGRGV
    EGHIHGQLYWLGNHRLATEREQITPELAGQLEALERQGRTAVMLGSAEHVLAIFGVADTLRETSRQAIAELHELNVKTVM
    LTGDNVHTAQAIATEVGIDDARGNQLPEDKLQVIEALAAQGATIGMVGDGINDAPALAKAHIGFAMGAAGTDTAIETADV
    ALMDDDLRKVPAFVRLSRSTAAILTQNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVFNGLRLLRK

    >gi|134094777|ref|YP_001099852.1| copper transporting ATPase, CopA transporter [Herminiimonas arsenicoxydans]
    MNNNAHDDHSHGDHSHHLKSSINSDERVKNPDKPFTDPVCGMRVAADPLKEIEYEGNKYHFCSAGCMHKFGVTPQAYIKP
    NTAGTAENMPSGTIYTCPMHPEIRQPTPGN
    CPICGMSLEPLMPSLEDEENPELVDFRRRFWWTLPLTIIVTFLAMGAHRF
    FPGGIPYQNWIELTLSTPVVLWAGWPFFERCYQSIVRRSPNMWTLIGAGVTAAYGYSVVATLAPGLFPSTFMEHGRVGVY
    YEAAAVIVSLTLLGQILELKARSQTSAAIKSLLGLAPKTARRINKDGTEEDVPLTHVHIGDALRVRPGEKVPVDGVVAEG
    ESAVDESMLTGEPMPVTKRQGDKVIGATLNTSGSLVIHSEKVGSQTMLSQIVQMVAQAQRSRAPMQRLADVVAGYFVLVV
    VGIAFLTLVGWGLFGPEPSWVFGFVNAVAVLIIACPCALGLATPMSIMAATGRAATQGMLFRDAAAIEGMRKVNTLIVDK
    TGTLTEGKPAFDRVIAAQGQTETSVLQVAASIDQGSEHPLAQAIVTEARKRSLTLDKPESFESSSGIGVRGIVAGHRIAL
    GNTALMDEEKIEWRSLSTQAEELRSEGASVMHVAVDGKLIGLVAVSDPIKTTTMEALSVLREAGINVIMATGDGVTTAKS
    VAGKLGISEVHGEVKPQDKLALVERLQKEGKVVAMAGDGINDAPALAKADVGIAMGTGTDVAINSAHLTLVKGDLRVIAR
    ARTLSLDTVRNMHQNLGFAFIYNALGIPLAAGLLYPFTGQLLSPMIAALAMSLSSVSVITNALRLRGTSK

    >gi|134094805|ref|YP_001099880.1| putative cadmium-transporting ATPase (cadmium efflux ATPase) [Herminiimonas arsenicoxydans]
    MAEIQRPQNKQSISDCCEGSNCRTSSNAAIQPFPAPLDAPSNAQSVQYRISNMDCPTEEKLIRNKLEGMNGIIRLDFNLM
    NRILSVHHQLKSLESVTTALKAIGMDAQLVDSEAHQPKVPESASLTAAQKILLAISGVAALAAEVLAWTTHTDGSPLVIA
    LAFISIATGGLPTLKKGWIALKTFTLNINFLMSLAVIGAMAIGQWPEAAMVVFLFAVAELIESLSLNRARNAVHGLLKLA
    PDVVTLQDAIGGWQEKSVETAVVGDMMRVKPGERIALDGIVTSGESSVNQAPITGESMPVDKRIGDAVYAGSINERGLLD
    IKVSTNSSNSTLARIVRVIEETQNNKAATQRFVDTFARYYTPAVVVMAILVAVIPPLVFGAEFTPWLYKALVMLVIACPC
    ALVISTPVTVVSGLTAAARLGILIKGGEFLEVGYKLKAIALDKTGTLTAGQPSVVDVKTISNNERETILLLAASLDANSD
    HPLANAIVKAGPESSLHKVVTNFEALPGRGVKGEIDGTIYFLGNHRLIEELKVCNPAIEALLDVIEGTAQTAVMLATEKT
    VVGIIAIADSLRESAIESVRQLNQLGITTVMLTGDNNRTAQQIGAHVGISVIKAELLPEDKLTEIKNLQSTYGVVGMLGD
    GINDAPALAQADVGFAMGAAGSDTAIETADVALMNDDLEKLPVFIKLSRATRSILIQNISAAIGIKAIFFVLAFMGIATL
    WMAVFADVGASLLVVFNGLRLLRK

    >gi|134094826|ref|YP_001099901.1| putative toxic metal efflux pump [Herminiimonas arsenicoxydans]
    MRAKKTLDPIVATESLIASVKPIQTGVSMHCCDHDHANADNQSAVPASAPVAGAEQVVLLIQKMDCPTEEKLIRDRFQHM
    EGIVGMQFNLMQRELTVQHNLMSVDAIVTALKKLDLVPIVKSDTLNLVRDGLDEHHDLSGDYRISRSKWLLMGISGVTAI
    GSEIVAWTTGADHSWPVIALALLAILTGGMDTLKKGWIALRHFSLNMNFLMSLAVMGAIAIGKWPEAAVVIFLFAAAEMI
    EAMSLDRARNAIKGLMAMTPEIATVRNSSGEWQTVAADQVVLDAIVRVKPGERLPLDGIIVNGQSTINQAPITGESMPVA
    RQIGDTVFAGTINEMGSFDYRVTALQSNSTLARIIKSVQQVQGERAPTQRFVDQFARYYIPAVVIMAVLVALLPPLLMQA
    PFQPWLYKALVLLVIACPCALVISTPVTVVSGLAAAARHGILIKGGLYLELGCKLKAIALDKTGTITLGKPVVTDMLVVG
    AGDVDNLLRLAASLSQRSDHPVSSAVLAWWKSRTSVQALSEVADFEALTGRGVKGAIGGASYYLGNHRLIHELDICGPEL
    EATLDAFERSGKTAIILASETAPLLILVAADTVRAGSAAAVAKLNALGVKVVMLTGDNPHTAEAIAAQVGIADARGNQLP
    DDKLAAINELLAQHACVGMVGDGINDAPALAKASIGFAMGAAGTDTALETADVALMDDNLDKLADFIGLSSKTHTILIQN
    IALALGIKAVFLVLALSGEATLWMAVFADMGASLIVVANGLRLLRAI

    >gi|134094830|ref|YP_001099905.1| resistance protein, osmotically inducible [Herminiimonas arsenicoxydans]
    MEHTGSAAWKGGIKDGIGSISVQTGVLKDAPYGFKARFEGGPGTNPEELIGAAHAGCFTMALSGELGKANLTADNLTTTA
    TVTLEKVPGGFSISKIHLDLVGKVPGTDQAGFEKIANDAKVG
    CPVSKLFKGNAEITLTARLEN

    >gi|134094855|ref|YP_001099930.1| cation transporting P-type ATPase [Herminiimonas arsenicoxydans]
    MNIHAQAEAGSVAQGATAFDGCYHCGLSLPPAAHWPVEIDGQRREMCCPGCQAAAQTIVEMGLADYYRTRSAFSATADGA
    ALIPPELLLYDLPDAQKKFDLNEESAEATLSIEGIR
    CAACVWLIERRLARLPGLQAVNLNVATERLYVRWQKELCKPSDV
    LQAVRDIGYAAYPYDASRHDAQLRRASRTLSRQLFVAGLSMMQVMMYAVPAYISHDGTLESDMDALMRWASLLLTLPAVC
    YSALPFFRGAYASLRQGALGMDVPVALGIGAAFIGSVVAVLRGDGDVYFDSVTMFIFLLLCSRYLELIARRKAAGALEKL
    QHALPAAAARMNGYPAQRECSMVAATQLCAGDFILVKPGEAIAADGEIVEGASAIDMSLLTGESAALKRGVGDTLPGGAI
    NITQAIVLRVSKVAADSTLSQLIRLIERAGNAKPQIALWADRVAAWFVAALLLFALAVFVFWQWHDPARAWPIAIAVLVV
    SCPCALSLATPTALAAATDRLVRQGVLIVQPHVLEILHRTTHIVFDKTGTLTVGKPTLQNMHMFADAERNACLQIAAALE
    ASNAHPLAQAIVVAASAAAMTATAPVAHDVSYTAGQGLEGVIDGVRFRLGNAVFVGELAGHSIDQQDGTGMTSVYLGSSG
    TWLARFDLSDAMRDDARAVVAYFRKLGKTVILLSGDQPDVAQHVAAELGIAEAHGACLPEQKLAFVQKLQQQGSIVAMVG
    DGINDAAVLRAADVSFAMGSGAALAQTHADTVLLSPHLAAIANASEVAVKTMRVIRQNLVWATCYNLLAIPAAAIGWINP
    WLSGVGMSLSSAVVVLNALRLRRIPRRHGEHPGRAKAEQENAGQENAMAAAVKQGIN

    >gi|134094941|ref|YP_001100016.1| hypothetical protein HEAR1735 [Herminiimonas arsenicoxydans]
    MNAPIPHAVCHLNDMPLANSFASLPPAHYTALMPTPLPAPYLVCASASAAALIGLDFSDIDSAAFIETFTGNRIPDGSRP
    LSAVYSGHQFGVWAGQLGDGRAILLGDVPAPTMIPSGRLELQLKGAGLTPYSRMGDGRAVLRSSIREFLCSEAMAALGIP
    TTRALCVTGSDQIVLREQRETAAVATRMAQSFVRFGSFEHWFYNEKHDELKTLADYVIAQFYPQFKTAENPYKALLTEVT
    LRTAQMIAHWQAVGFMHGVMNTDNMSILGLTLDYGPFGFMEAFNATHICNHTDQQGRYSYARQPQIGEWNCYALGQTLLP
    LIGDVDETQNALRIYKPAYAEKFAELMRAKLGLQTQQPDDGKLFDALFAVLQGSHADFTLFFRRLGELRIGQAASREALR
    DLFLDRAAFDDWALQYELRLQLENSDDDARKLAMHAVNPKYVLRNYLAQIAIEKAQNKDFSEVAKLLQVLEKPFDEQPEN
    EKYAALPPDWANDLEVS
    CSS

    >gi|134094942|ref|YP_001100017.1| methionine sulfoxide reductase [Herminiimonas arsenicoxydans]
    MTEKVIKTDAEWRAMLDDEEYDVTRHAATEAPFSGRYWDHHEHGIYTCVCCNTPLFASDAKFDSGCGWPSYFTALNPDNV
    KEKIDRAYGMIRTEVICNVCDAHLGHVFNDGPPPTGLRY
    CINSASLRFDATPDLNES

    >gi|134094971|ref|YP_001100046.1| putative thioredoxin-like protein (partial) [Herminiimonas arsenicoxydans]
    MSSITLEPENQHQLAQRMQDDVWVVACLCAAWCDVCTSYRPGFDELAAQHPDKLFIWIDIEDRADLIGDFDVENFPTLLI
    QRGDDVMFYGTTIPDHRIAHRLITAHADKTDAELKMQAHSSAEYRSWQVERNLRKALA

    >gi|134094976|ref|YP_001100051.1| dihydrolipoamide dehydrogenase [Herminiimonas arsenicoxydans]
    MSKNFDVVVIGGGPGGYVAAIRAAQLGFSVACIDEWKNAKGGAAPGGTCTNVGCIPSKALLQSSEHYEHAGHAFAEHGIE
    VKDLTLNVKKMVARKDTVVKQNNDGILYLLKKNKVTFFHGRGSFAKAGAGGYEIKVAGAGEETIATKHVIVATGSTPRVL
    PGADFDEKMILSNTGALAMTEVPKRLGLIGAGVIGLEMGSVWRRLGSEVTVLEALPVFLGAVDEQVAKEAQKQFVKQGLA
    INLGVKIGAIAVGKNEVTVNYVDDKGAAQKAVFDKLIVSIGRIPNTVGLNTEAVGLKLDERGFIAVDGDCKTSLPNVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPSVIYTSPEIASVGKTEQQLKAENIAYKAGTFPFLANGRARALG
    DTTGFVKFLADAKTDEILGVHIIGPQASELISEAVVAMEFRASSEDIARICHAHPTLSEALKEAALAVDGRSLNF

    >gi|134095158|ref|YP_001100233.1| arsenate reductase (glutaredoxin) [Herminiimonas arsenicoxydans]
    MSHITIYHNPDCGTSRNVLSLIRNSGEEPAVIEYLKTPPDRDMLKALIAAMGIPVRAVLREKGTPYAELGLGDQKWSDEQ
    LIDFMLQHPILINRPIVVTPLGTRLCRPSETVLDILPQPQRGAFNKEDGEPVVDVEGRRV

    >gi|134095257|ref|YP_001100332.1| hypothetical protein HEAR2067 [Herminiimonas arsenicoxydans]
    MIKFTLYSRTYCHLCDDMLAALHALNISEAHSVSVVDVDADALLLAQYDELVPVLVAGKGARPAQQLCHYFLDEAAVRAF
    VAGAESDVRREEL

    >gi|134095338|ref|YP_001100413.1| bacterioferritin comigratory protein (blue copper protein like) [Herminiimonas arsenicoxydans]
    MDQDIAVAERPSALNQNVPDFSAAMTGNQTFQLSDYKGKRIVLYFYPKDNTPGCTTEGIQFREMYSQFQAANAEIVGVSR
    DSIRSHEGFKEKLALPFELISDPDETLCTMFDVMKMKNMYGKKVRGIERSTFIIDESGKLVKEWRGVKVPGHIDEVLEFV
    KALT

    >gi|134095418|ref|YP_001100493.1| factor involved in Fe-S cluster assembly and activation [Herminiimonas arsenicoxydans]
    MAITLTEKAAKHINRYMERRGKGIGLRFGVRTTGCSGLAYKLEYVDESASEDSVFESHGVKVFVDPKSLPYIDGTELDFA
    REGLNEGFKFHNPNVKDECGCGESFRI

    >gi|134095704|ref|YP_001100779.1| putative thiol:disulfide interchange protein [Herminiimonas arsenicoxydans]
    MVAVLSARVAFVIQYKTAYLSIPLDIIDIRDGGWNAQAGVIAAWAYALLLMKGKACLRKPLLLVMFGSSLVWIGGTIALA
    ALTKDPSPIPDLKLQSMNGDEVYLARFDGKPTVINLWATW
    CPPCQREMPVFAKAQQQNPGIHFVFINQGESRLLVEQFLT
    KNKLTMQNVLIDASGAAGKAFEVKGMPSTYFFDANGKLLDSRLGEVSDASLMEKLQKINP

    >gi|134095770|ref|YP_001100845.1| peptide methionine sulfoxide reductase (protein-methionine-S-oxide reductase) (peptide Met(O) reductase) [Herminiimonas arsenicoxydans]
    MTTEIATLGGGCFWCTEAVFQQMKGITAIESGYTGGQVANPSYEQICEGTTGHAEVVRLTFDPAVVSFREILEVFFTIHD
    PTTLNRQGNDVGTQYRSVIYYHTPEQQDMARHVMAEMANVWDAPIVTELSPAETYYKAEDYHQNYFRQNPLQGYCAFIVA
    PKVAKFRQTFRDKIRADMS

    >gi|134095876|ref|YP_001100951.1| putative thiosulfate sulfurtransferase [Herminiimonas arsenicoxydans]
    MQHITAPELAALLADGSGKARILLDVREPWEYQTCRIEGAISIPMNTIPDQLAQLDKDAAIVCICHHGARSMRVAHFLES
    QGYTHVTNLTGGIHAWAQQVDPAMPTY

    >gi|134095923|ref|YP_001100998.1| thioredoxin-related transmembrane protein [Herminiimonas arsenicoxydans]
    MKRNVFVFGIFALVFAGIGIYFGNRHHTPAAPESPAVATFFAQQLEDADGKTHALSQWQGKTLIVNFWATWCAPCVEEMP
    ELTALQTELAPQGIQILGLGIDNPSNIREFAAKYKISYPLYIAGMTGTELSRQFGNQAGGLPFTVIIGPNGDIKKTYLGR
    LKMEQLRADIHSL

    >gi|134095964|ref|YP_001101039.1| putative alkyl hydroperoxide reductase. putative member of the AhpC/TSA-family protein [Herminiimonas arsenicoxydans]
    MTIKIGDQLPEARLAEYIDVASEACSVGPSKVMVHEATKGKKIAIFAVPGAFTPTCSETHAPGYIKAADQFKAKGVDEIW
    CISVNDPFVMGAWGRDQKAAGKVRFIADGSGTFTKALGMEFDLTKGGLGVRSQRYSMLVEDGVVKQLNVEDSGHLEVSTA
    EKLLEQI

    >gi|134096085|ref|YP_001101160.1| glutathione peroxidase [Herminiimonas arsenicoxydans]
    MKKSLFTLVCGTLLTVLFGTAHIASAQTAAPAACPATLNHVVPRLQDEAPQNLCQYAGKVVLVVNTASYCGFTVQYEGLE
    QLYAKYQPQGLVVLGFASNDFGQQEPGANKEIAEFCKNTYGVKFPMFAKSSVIGPNSNPVYLSLMKAGAKPPQWNFHKIL
    LGRDGKVIASYPSKIRPDDKKMIADLEQALAKK

    >gi|134096129|ref|YP_001101204.1| glutaredoxin 3 [Herminiimonas arsenicoxydans]
    MTAHVVMYSSGVCPYCTMAERLLTAKGISNIEKIRIDLDPAQRAAMMQKTGRRTVPQIYVGDTHVGGFDDLNALERLGKL
    DALLQGA

    >gi|134096130|ref|YP_001101205.1| thiosulfate sulfurtransferase [Herminiimonas arsenicoxydans]
    MKFIIDNIFLIGIVLVSGGALIVHTLQRTGAKVTALQATQIINQGKVLILDVRNAADFALGHIRDAKNIPLKELKTRVSE
    LEKFKERPVIVV
    CTKGLQSVKATAQLKKAGYANAASLLGGLDAWQSQGLPVVK

    >gi|134096134|ref|YP_001101209.1| thiazole biosynthesis protein [Herminiimonas arsenicoxydans]
    MTDQESRITPGLFMNDQQLLRYSRHILLDEIDIEGQEKLLAAHALIIGAGGLGSPAAFYLASAGIGTITLVDDDTVDLTN
    LQRQILHTTERVGQAKVVSGQKTLAEINPTIEIIALQERVSGERLDELVRNASVVLDCCDNFATRHAINRACVANRVPLV
    SGAAIKFDGQVSVFDTRSDKAPCYACLFPEDQQFEEVN
    CGTMGVFAPLVGIIGSTQAAEALKLVAGIGASLTGRLLLLDA
    RTMEWSSIKIARNASCSVCGQAH

    >gi|134096174|ref|YP_001101249.1| hypothetical protein HEAR3019 [Herminiimonas arsenicoxydans]
    MSDDVQSWIKETVTQNPVVLFMKGTAQFPQCGFSGKAIALLKESGVTDLVTVNVLDDAEVRQGIKDFSQWPTVPQLYVKG
    EFIGGSDIMNEMFASGELQALLKA

    >gi|134096204|ref|YP_001101279.1| putative stringent starvation protein A [Herminiimonas arsenicoxydans]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEVRDVDLFNKPEDISTMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPLMRARARLMLFNFEKELFIHVHVLENDKGRSGEKAQEKARNEIRDRLTTLAPLFLKNKYMLGDEFSMLDVAIAPLL
    WRLDHYGIELSKTAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|134096292|ref|YP_001101367.1| putative peroxiredoxin [Herminiimonas arsenicoxydans]
    MMTLRLGDIAPDFEQDSSIGKIKFHEWAGDSWVVLFSHPADFTPVCTTELGLTAKLKPQFDKRNVKAIALSVDPADQHLE
    WIKDIEATQKTVVGFPIVADADKSVSTLYDMIHPNQSATATVRSVFIIDPQKKIRLTLTYPMSVGRNFDEILRAIDALQL
    TDNYTVATPGNWRDGDDVIIPLSIQDEAVIKQKFPKGYKAERPYLRVTPQPNK

    >gi|134096293|ref|YP_001101368.1| thiol:disulfide interchange protein, cytochrome c-type biogenesis, electron carrier, N-terminal interacts with and activates DsbC [Herminiimonas arsenicoxydans]
    MSRVFALLALLCTLPLLAHADEDFLAPEIAFQFSARMVDTKTIAVTYAIADGYYMYRERFAFKASDAALGEAVIPAGKVE
    FDQTFQKDVETYRKSVTIRIPVQASGRFTLTASSQGCSDKGLCYSPMDSQANLFAQGDGAKSGAPDKGLKILSASDDATK
    NVVLDAETGRIERALQSGELLAILPLFLLLGLGLAFTPCVLPMVPILSSIIIGEGAQTKRSRGLLLAVVYSLGMALVYTC
    LGLAAGWVGEGLSAALQNPWVLSGFAILMVGLALSMFDVYHLQMPAFVQHRLTRASERQSAGKLVGVFVMGALSALIVGP
    CVAAPLAGALLYISQTRDLVIGGSALFAMAIGMSVPLLLVGASAGTLLPRTGAWMNGVKRFFGVLMLALAIWMISPVIPA
    VVQMLALAALGLAYGAYLLWGAKGSWFAKALGLVFAILGAMQLVGVSTGGRDAWAPLAHLSADGVRKPVFVRVKTSAELD
    AAIAQAGGKNVMLDFYADW
    CVSCIEMEKFTFTDPRVHAQFADMVLLQVDVTANNAYDKEMLRRFNLFGPPAIIFFDKNGQ
    EIRGGRVIGFQKADKFTQSLALIKQF

    >gi|134096337|ref|YP_001101412.1| hypothetical protein HEAR3183 [Herminiimonas arsenicoxydans]
    MRECQPDCRRKGIMQEQHLSIHSRHFQCRHIMLIIYHNPRCSKSRGALEQVQQFATQNQLDLNIVDYQKTPLDLMQLTEL
    HQLLQADTTCSVRDMVRDNEALFDTLSLQQADDDSLLQALAAHPQLLQRPIVRFNNRALIARPPELLDNFLQMS

    >gi|134096424|ref|YP_001101499.1| hypothetical protein HEAR3271 [Herminiimonas arsenicoxydans]
    MEIKVTKGAGKLQHIVQAGPHTLIADAPSAFGGEDAGFVPHDLLAAALGACTAVTLNMYAGRKEIPLEKVDVTVVAAEQD
    GVYVFNRALHYHGNLSTEQKENLNKIADK
    CPVHKALSGEIRIITQAN

    >gi|134096449|ref|YP_001101524.1| copper transporting ATPase [Herminiimonas arsenicoxydans]
    MSSPAVSDSIHRITLDVAGMTCASCAGRVEKAINAIPGVTKTSVNLATDSVAVEVDHAAAVDAATVQQAIEKAGYSVPQQ
    EIELDITGMT
    CASCAGRVEKALRKVDGVLDASINLATDRARIKVSGATSAAALIAAVDGAGYGAALPREPSGAASSTSTA
    TSGDWLPVVLSALLAIPLVLPMLLEPFGVHFMLPGWLQWALATPVQFWLGARFYKAGWHAVKAGTGNMDLLVALGTSAAY
    GLSIYLLLTAMPDQMPHLYFEAAVVVITLILLGKWLEARAKKQTASAIRALQKLRPESARVRRGGNDIDVAINAVRVGDI
    VVVRPGERIAVDGTVLEGSSQVDESLITGESLPVLKQVGDKVTGAAINADGVLLVRTDAIGAETTLSRIIRMVENAQSEK
    APIQRLVDKVSAIFVPVVLAIALFTFIGWWLAGSSMETAIINAVTVLVIACPCALGLATPTAIMAGTGVAARYGILIKDA
    EALEIAHRITTVVFDKTGTLTQGKPQVSEFLTNGIAEDKLLQLAAAIQRDSEHPLGRAVVERAAARHLALLESTAVQALP
    GRGMQATVEGRPLQLGNARLMGELGIDMTQFAQRAQQLEESGHTVSWLAETGAQAGVLGLIAFRDTIKHSAPQAVERLHA
    LGIQTILLTGDNQGNANAVGRQLGIDRVLAQVLPGDKSAKISALQDEGQIVAMVGDGINDAPALAAAHVGIAMATGTDVA
    MHAAGITLMRGDPALVADAIDISRRTYNKIRQNLFWAFIYNLVGIPLAAFGLLNPMFAGAAMAFSSVSVISNALLLRRWQ
    PATGEARKTLSTHTV

    >gi|134096465|ref|YP_001101540.1| hypothetical protein HEAR3313 [Herminiimonas arsenicoxydans]
    MTRICPKCSYVRKPTDEAPEWQCPSCQVAYIKASGEPAPAGYGRYGTPVAKNGSPFSAVLKWLIVLAVLGAAVYMSKPLW
    TGGKAANVAVSSAQPAVTLYATEW
    CGYCAAARQLFEANGIEYTELDVEKTSAGYEGHKKLGGNGVPLIVVDDKVIHGFDE
    RTLRTTLKPWFKQS

    >gi|134096501|ref|YP_001101576.1| dihydrolipoamide dehydrogenase [Herminiimonas arsenicoxydans]
    MKTLEFDVAVIGAGSAGMSAYRAAKTHGKRVALIESGPYGTTCARVGCMPSKLLIAAAEAAHAVGEAPGFGVHAGALRID
    GKAVMQRVRSERDRFVGFVVQGIEHIDPADRLRSHARFLAADCLQVGEHTQVQAQCVVIASGSSPQIPPELSGLGKQLIV
    SDDVFDWDDLPASVAVIGTGVIGLELGQALHRLGVRVAIFGRKARVAQLSDPAVNQTAIACLGAELDLRLNTTIVTARLS
    GAQVELHTRSADGDERTEHFQYVLAATGRTPNVRGLGLETTGLQLNEQGLPTFDPSTMQCGDSAIFIAGDVDNDRPLLHE
    ASDEGRIAGDNAGRFPAVAAGLRRVPLAIAFTDPQIAMIGHTPRTLKKGCFQSGEVSFEDQGRSRVMRQNRGLLRVYGEP
    GSLRFLGAEMTGPRAEHLAHLLAWACQSGMTVDQMLDMPFYHPVVEEGLRTALRNLKENLLQHVSAIEHCADCTPGV

    >gi|134093522|ref|YP_001098597.1| putative OsmC-like protein [Herminiimonas arsenicoxydans]
    MECTVRWTGLSGMTFLAETGSGHVVAMDGAPEGGGRNLAPRPMEVVLLGTGGCTAYDVVVILRKSGQDVRGCEVSLKSER
    AETDPKVFTKVHFHFTVSGRNLKANVVERAIKLSHDKYCSASIMMEKTAEITHSFEIVDDAAPAAI

    >gi|134095640|ref|YP_001100715.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S protein [Herminiimonas arsenicoxydans]
    MDKEILLAQPRGFCAGVDRAIEIVERALIEFGAPIYVRHEIVHNAYVVSDLRNKGAIFIEELEDVPAGNTVVFSAHGVSK
    AVQAEANERGLRVFDAT
    CPLVTKVHIEVEKMRRDGREIVMIGHDGHPEVEGTMGQTEDGMHLVETVDDVKNLQVKNPELV
    SYVTQTTLSIDDTADVIAALKNKYPHISEPKKADICYATTNRQEAVKFMAPQVDVVIVVGSPNSSNSNRLREVARKKNVP
    SYMVDNASEIDPAWLQDKQRIGVTAGASAPEVLVQAVIDKLKEYGAKSVRTLEGVEEHVAFPLPKGLVRKTADA