Heliobacterium modesticaldum Ice1 uid58279

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|167628500|ref|YP_001678999.1| thioredoxin reductase [Heliobacterium modesticaldum Ice1]
    MSDRYDSVVIGCGPAGLSAALNLHIRNKAFILLGTKQCSHRLAKAERIDNYLGLPEISGKELMDRYLHHVSSRGIELREE
    RVTAVYPGDGAFAVVTGKGQYTARSLIVATGVHIEKVLPGENEFLGRGVSY
    CATCDGPLFRGKRVALIDYTGGAAYDEVL
    FLASVADTLYYLLPEGKTASATAAVKLPLPANVTQLRRSSLSIKGADTVTSLVADEQEFALDGVFILRETQKAEILVPGL
    ATDDKAVTVDGQMATNIPGVFAAGDCTGKPYQLARAVGQGAVAALSAVGYLDNPRN

    >gi|167628498|ref|YP_001678997.1| cytochrome c assembly protein (thioredoxin), putative [Heliobacterium modesticaldum Ice1]
    MTKTMTKWSRWCFVPLLALSLTTAGCVSSNTGAGALEQPPRSTNTSNEAAKERLKAPDFKLMSLYGKEESLSAYQGKPVV
    VNFWASW
    CAPCRNEMPDLNEFAKEYEGKVVVLGVNLTFNDKEKDVRNLVQKLDIKFPILLDNDPNNSAAEAYRIQPIPAT
    FFIDKNGNIADVLIGAARSKNDFIKRVEPLLE

    >gi|167629051|ref|YP_001679550.1| 6-o-methylguanine DNA methyltransferase [Heliobacterium modesticaldum Ice1]
    MAEEHCTYYASPIGLIEIRGSEQGIWTISFAEEADGHGQRQGTGRLPPCLQACARQLDEYFQGARQTFSLALAPRGTAFQ
    RRVWDALAAIPFGESRSYRQIAEAVGNPKAVRAVGGANHNNPISIVIP
    CHRVIGSDGSLTGYAGGLWRKEWLLNHEKRLD
    KEALLMP

    >gi|167629096|ref|YP_001679595.1| thioredoxin reductase [Heliobacterium modesticaldum Ice1]
    MLIIGAGPAGLTAGLYASRAGLRTAIFEAVMPGGQAATTEIIENYPGFDKPISGPELMMRFMAQAQRFGAELISEQVIKT
    SLRGHLKRVETPGGVRYARSVIIATGAQPRRLGVKGEADFHGRGVSY
    CATCDGAFFRGRKVVVVGGGNSAVEEALFLTKF
    ATEVTIVHRRDQLRATKVLQERAFQNPKIRFVWDTVIEEIVGGAAVEKVRTRNSKTGEAGEIACDGVFVFVGHSPAADYL
    VDPLDRTEEGYIAVDANLAASIPGVFACGDVRNTVLRQVATAVGDGAVAAISAERYLSGHR

    >gi|167629247|ref|YP_001679746.1| fad-dependant pyridine nucleotide-disulphide oxidoreductase, putative [Heliobacterium modesticaldum Ice1]
    MSKKVVIVGGVAGGASAAARLRRLDEQAEIIIFERDGYISFANCGLPYYIGETIVERSNLILQTPQMMLDRFNIDARLHS
    EVVSIDSAKKSVTVKSADRGVYEESYDVLVLSPGAKPFVPPIAGVGSDKIFTVRNIPDADRIKAVVDNIARKKERTAAVV
    IGGGFIGVEMAENLIERGIPVTLVEAAPHILPPFDDDMVTLAEKELSDHGVRMILGDGVREFAEIPGGDEIEVTLLSGTR
    LKAGMVILAIGVKPDVDFLKGSGLQFGPRGHIIVNDRMQTNLDSVYAVGDAIQVVDFVNGGETTIPLAGPANKQGRVAAD
    NICGIDSRFRGSQGTSIIKIFGLTGAMTGNNERNLRRLGMAYRVVHVHPNSHASYYPGATPIALKVLFAETGKVLGAQAF
    GYDGVDKRIDVIATVIRMGGTVDDLKELELAYAPPYSSAKDPVNMAGFLAENVLAGRADLFTSSDIDGMDREKAVLLDVR
    SELEYENGHIPGAIHIPVDALRDRLGELDPSKEYWLY
    CRVGFRGYLAERILKQRGFKARNLSGGYMSYEIARYQVGETAS
    SQQMPALDGCGCDYTKEKVAAPGLKSGQQMPARGGCDCGGSGNGNGKGDDAC

    >gi|167629287|ref|YP_001679786.1| redox-active disulfide protein 2, putative [Heliobacterium modesticaldum Ice1]
    MEIKVLGAGCAKCNQLEALVKQTLQELGKEANVEKVTDFPTIMSFGVMATPALVVDGKVKVSGRIPSAAEVKSFLG

    >gi|167629699|ref|YP_001680198.1| ferridoxin/ hydrogenase, putative [Heliobacterium modesticaldum Ice1]
    MSNGSVNGRKYETTIQMIRHEVFYQVAKMAMEGSLQAHREFIPVIVFQGNKARFRCCVYKERAVAAERVRLACGEAPQSG
    VAYEAAESGIPDPLVRVIAIACDECPVDRFTVTGACRG
    CITHRCIEACPVDAIAQINRLAYINQQKCIECGRCHQVCPYG
    AITDMQRPCIKACPVKAIQYGEDKIARIDPNKCVSCGHCAVSCPFGAISDLSYIPQAVEMLKTQDGTVHAVLAPSVASQF
    PGISIGQVHHALKKLGFAAVHEAALGADMIVDHEAKELAEKLKEGSFLTNSCCPAFVSLIEKHFPTLKGNISTSVSPMVA
    VGRYVKKLHPEAKTVFIGPCYAKKVEIGLPKCKGHIDLALTFEEIFAMFDAAGISLADCPDEPLQQASPFGRRFARCGGV
    SEAIAQALKEAGVQVELKPVQVDGLDACIKVLRQAKVGRPPGNFIEGMACVGGCVGGPASLNHTRKARQIIDTYSEETKA
    KTITEALSAIETP

    >gi|167629725|ref|YP_001680224.1| conserved hypothetical protein containing a thioredoxin domain [Heliobacterium modesticaldum Ice1]
    MTGPTSRKPNRLIQEKSPYLLQHAYNPVEWYPWGEEAFTRAKEQDKPVFLSVGYSTCHWCHVMERESFEDEEVAAYLNEH
    FISVKVDREERPDVDHIYMTVCQAITGHGGWPLTVIMTPDKKPFFAGTYFPKRSRQGLAGLLDILEAVVDQWKNDRGKLV
    AAGDRVTQHLQREVQANSAGSLDDASILRGYAWLQKRFDDVYGGFGHAPKFPTPHNLLFLLRCDKLINAKEALPMVEKTL
    RQMHAGGIYDHLGYGFSRYSTDEKWLVPHFEKMLYDNAQLAMAYLEAYQVTAKDEYAEVAREIFSYVLRDMHAPEGGFYS
    AEDADSEGVEGKFYLWTPQEVKEILGEETGKLFCQWYDITEKGNFEGQNILNRIDADRRPFTPPMGWHQILTDAEEKLFV
    AREKRVHPLKDEKILTAWNGLMIAALAMGFRILYDRSYLDAAIGAADFIWEKLRDDKGRLLARYRDGEAAYKGYIDDYAF
    MIWALIELYQADTNPLWLKRALTLQEDQNRLFWDPDQGGYFFYGSDSEELLTRPKEIYDGATPSGNSVSALNLLRLARIT
    GRNAYARQAETLLESFSGNINAQPAGHTFALMALLFARRPGKEVVVVADRKRETFRQELERLHSPFSPETVFLYRLADRE
    YKDLAELAPFVENMAPQGDSPTYYVCENFACKPPTTNPREVWEILAR

    >gi|167629737|ref|YP_001680236.1| redox-active disulfide protein 2, putative [Heliobacterium modesticaldum Ice1]
    MLNVKIFGRKCKNCIEMAALVERVLPTMGVAYSLEQVYDFKEVMKHGFITIPVLMINDEVVAVGQVPSEEAFIEKINALV
    GGK

    >gi|167629780|ref|YP_001680279.1| copper ion binding protein, putative [Heliobacterium modesticaldum Ice1]
    MTDVTLKVEGMSCGHCKAAVEKALKGLPGVASVAVDLAAKEVAVRFDGTETGIEAIKTAIDDAGYDVVS

    >gi|167629781|ref|YP_001680280.1| copper-translocating p-type ATPase [Heliobacterium modesticaldum Ice1]
    MTDGSGGDNAAVAKVTLLVSGMTCAACANRIERKLNRLPGVITASVNLTTEKAVVEFYSGEVKAGDLIEAVVALGFQARL
    AEAVVSADSEQEQLRRQWLLFGASAALSLPLLLVMIGEMTGLPLPVWLLAKQTQFLLATPVQFGAGWSFYRGAWKALKNG
    SANMDVLVALGTSAAYFYSVYVTFFSPAAHHTDHVYYETSSILITLILLGKTLEAVAKGRTSEAIKKLMGLKAKRARVIR
    GGRELDIPVEAVLAGDLVVVRPGEKIPVDGVVEEGASAVDESMLTGESLPVDKQPGDTVIGATLNKQGSFKFRATKVGRD
    TALAQIISVVEEAQGSKAPIQRLADTISGYFVPVVVSLAVITFFVWYFAVAPENFTRALLNFTAVLVIACPCALGLATPT
    SIMVGTGKGAEKGILFKGGEHLENAHKVTAVILDKTGTITKGKPELTDLIGLGDWAGREAELLTIAGQVEKPSEHPLAEA
    IVKKAAESGSPIKDPERFQAIPGHGVIATVDGRQALLGTRRLMAEQGLSYREHEPLLERLEKEGKTAMLLALDGQVIAAI
    AVADTVKESSAQAIAELKAMGIQVWMITGDNRRTAESIAQKTGVDHVIAEVLPEDKAREVQKRKEEGHVVAMVGDGINDA
    PALAMADVGMAIGTGADVAMAAADITLMSGDLRAIAAAIRLSRATMANIRQNLFWALIYNSLGIPVAAAGFLSPVIAGGA
    MAFSSVSVVMNALRLRRVEPYRPERL

    >gi|167629919|ref|YP_001680418.1| thif family protein [Heliobacterium modesticaldum Ice1]
    MKQQAFARTELLIGDEGIERLASASVAVFGVGGVGSFTVEALARCGVGSLVLVDHDEICLTNVNRQLHALHSTVGRAKVE
    VMAERVKDIHPQAKVTCYRRFYGVEAGEEIITPELDYVVDAIDTVKGKLTIIERARAVGVPVVSALGAGNKLDPTRFQVA
    DIYETTMDPLAKVMRKELRKRGVDKLKVVYSTEAPRPLRGEAACADNCICPHPKGPFGAS
    CKQKRQIPGSISFVPSVAGL
    IVASVVVRDILEASGLLTAAK

    >gi|167629921|ref|YP_001680420.1| thioredoxin [Heliobacterium modesticaldum Ice1]
    MASANVVALTDDNFRTQVLQSSKPVLVDFWAAWCGPCKMIAPIIDEVADAMAGKAVVGKLNVDENRATAAEYGIMSIPTL
    LVFKGGQVVDKAIGFKPKDELIKLLNKHI

    >gi|167630077|ref|YP_001680576.1| heterodisulfide reductase, subunit a [Heliobacterium modesticaldum Ice1]
    MKRIGVFVCHCGTNIANTVDCAKVAERAKDFPGVVFACDYKYMCSEPGQVMIQEAIGEHNLDGYVVAACSPRMHESTFRK
    CAERAGMNPYMVEQVNIREQCSWVHADKTKGTEKSIDITRMGVAKVAKNEPLFSTTIPVTKRALVIGAGIAGIQAAIDIA
    DAGYPVTLLDREHSMGGKMAQVDKTFPTLDCSA
    CILTPKMVEAAQHPNIEIVTYAEVEAVDGFVGNFDVTIRKKARYVDV
    NKCTGCGLCSEKCPKKVVSEFEMKLGTRKAIYVPFPQAVPNKPVIDAKNCRYLSEGKCGVCKKVCPTGAVDFEQKDELIV
    ERFGAIVVATGFEQFDISKYEEYGAGRIADVITGLHLERLMNASGPTMGKIKRPSDGKVPERIVFIKCVGSRDEAKGRPY
    CSRACCMYVAKHATLLKEKLPAAKSYIFYMDVRTAGKNYEEFYARAQNEYDAQYIRGRVSKIFQAGDKLIVRGEDSLLGR
    PVEIEADLVVLAAGMDPQQDAKDLARTLGISYDQHGWFTEAHPKLRPVETHTAGIFLAGACQGPKDIPDSVAQASAAAVK
    VASLLSKKELTAEAQTARCDEAYCSGCGLCVSICPYKAIELKRISERVHGGTRERQVSSVNQGLCQGCGACSVACPSSAM
    NLKGFSNDQILAEVDALCQR

    >gi|167630117|ref|YP_001680616.1| molybdopterin biosynthesis protein moeb, putative [Heliobacterium modesticaldum Ice1]
    MERYIKQIRFGAFGEAGQRRLVQSTVLVAGVGALGTHLANTLARAGVGKLVLVDRDFVELSNLQRQILYDEADAAAMAPK
    AVAAKQKLQAINSEIQVEAIVADIHWANLPQLLDGVDLVLDGSDNFDLRYLLNDACVQAGIPWIYGGVTGAHGMAMVVRP
    GQGPCLRCLIPSPPPPGAAPT
    CDMVGILAPAIQMITAFQAVEAMKLLAGREDELAGGLFSVDLWNSRYDLIDLTAARRDD
    CPACSRRDFPFLAGREEMQATPLCGSNAVQITPARPAELDLEAMSERLSGAGKVEVTPYLLRFASAEGEMVLFRDGRAMI
    RGTQDPVKAKAVYMRFIGA

    >gi|167630393|ref|YP_001680892.1| thioredoxin reductase, putative [Heliobacterium modesticaldum Ice1]
    MRFDIIVIGSGAAGLSTAIQLARYNHSVLVFDGGEGRTSWVPRYHNLLGYPQGISGKELLRLGREQAQLYGAEIVKSQVG
    RIERTGDGDFTVTTSSADYRSRYLVFATGLTDNQPEIPNRYEFAGRSLYY
    CLDCNGFEFIGQKAAVLGHSSGTIRSAFAL
    LDYTHHVFIATNGHPLEGREEYGDLLKEYKIDVIETPVERFQGTPGGKGKLKALSFQDGSVRDADVALSTYGTQGNSKLA
    QELNVAVNETGHIVVNEFMETAVPHIYAVGDVINTTQMLVFAISEGVKAAMMIHRSIESKRQPFQA

    >gi|167630794|ref|YP_001681293.1| conserved hypothetical protein, possible rhodanese-like domain [Heliobacterium modesticaldum Ice1]
    MDFIEMIATAAIGAIMIRLAARYFFGSDSDIGYEEALRILADREQSLLLDVRTAREYEKRRPAGAINIPLQELKQRLAEL
    EPHRNKQIVVI
    CASGMRSRMAVQTLQKQGFAGVKNFRGGMGSWRGEVESG

    >gi|167630833|ref|YP_001681332.1| cadmium-translocating p-type ATPase [Heliobacterium modesticaldum Ice1]
    MTTSCNGNCACSCSAAAENAGTAKSVDAIAVVSGTGAPAAVTGAFAEAATTAAAVTADPVLRYYIDGLDCADCAAKVEKI
    LSQQAGVRWVRIDFGAGALTLSPIEPAFSLPTITSVVSSLGYRLRLPEGAGGSRAAQETGTMAGKEPRWRRLNLRAARPV
    LSGLGLALGLLLDQTAATALSPLAYAFAIVAGGWPIARAAWTALKALTLDMNVLMLLAVAGAIAIQEWSEAAAVVFLFSL
    GAVLQASTLDKTRRSIRSLLSLTPAVATVSRNGVESTEPVEQIIPGDMIIVRPGDRIPLDGQVLRGVSSVNQAPVTGEST
    PVEKEPGDGVFAGTVNENGLLEILVTRPASDSAVARIIRLVEEAQSRRAPAQQFVDRFAAVYTPTVIVLAALVAVVPPLF
    GAPWEEWFYRALELLVVSCPCALVISTPVAIVAAIGNGAKQGVLIKGGAHLEELGRINTIAFDKTGTLTVGRPAVAHFLN
    VAPPDQHDDQALLSIAWRLERRSSHPLAAAIVRFAEERLPATAHGDLSELKGYATLPGAGVSAVIGGVPYALTSPGRSPV
    ASALPENLLAQIDTWQRDGYTVSLLSDDRRPLALFALSDACRPESGRVLARLKAAGVSHIAMLTGDNSHTARRIAAELSI
    DEVHAELLPAEKAETVQALMRPERRVAMVGDGINDAPALTAAHLGVAMGGYGSDMAMETADVILASGRLEQLPFAIRLGR
    SALSIIRQNIIFALVVKAVALLLILPNWLNLWLAVLSDTGAALVVILNALRLLNINTLSPDRPR

    >gi|167631016|ref|YP_001681515.1| bacterioferritin comigratory protein [Heliobacterium modesticaldum Ice1]
    MKEAQGHIFMEELLIGQKAPDFELPASNGKTVRLSQYAGNAVVLYFYPKDNTAGCTLEAREFRDLYDQFVQKKAVILGVS
    RDSVQSHERFAAKQGLPFLLLSDRDGAVCNAYQVLKEKTLYGKKSIGIERSTFIIDPEGNIQQIYRKVKSAGHAAAVLQA
    LQQR

    >gi|167629286|ref|YP_001679785.1| thioredoxin domain protein, putative [Heliobacterium modesticaldum Ice1]
    MSKTVRWAILGLVFFAVASILAYKEYQTTGSDRLLSSTPFQSEKTEFVNASIVIENAKKAKKPAWILFHSQTCQSCVEME
    QLFRKIEPELNQKIAFVDVDVNDPANKYLLRNFEVRMIPTTVLLDGHGEKHWVRVGAIAEAELRNRLERLAGAS