Helicobacter pylori SJM180 uid53541

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308183932|ref|YP_003928065.1| bacterioferritin comigratory protein [Helicobacter pylori SJM180]
    MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTPGCTLEAKDFSALFSEFEKKNAVVVGVSPDNAQSHQK
    FISQCSLNVILLCDEDKKAANLYKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL

    >gi|308184027|ref|YP_003928160.1| bifunctional methioninesulfoxide reductaseA/B protein [Helicobacter pylori SJM180]
    MKVLSYLKNFYLFLAIGAIMQANENMGSKLPKTDERVIYLAGGCFWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHE
    SDHAESVKVIYDPKKISLDKLLRYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
    PLKNYVRAEEYHQDYLKKNPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEE
    GIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRY
    CIN
    SAALRFIPLKDMEKEGYGEFIPYIKRGELKKYINDKKSH

    >gi|308184036|ref|YP_003928169.1| hypothetical protein HPSJM_01280 [Helicobacter pylori SJM180]
    MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLVVS
    KDGNLVIGLGGIFFSNNAGDVKLLTETNQKILALNTNQQNSAKLNAIFNEIPADYAIELPSTNAENKDKILYIVSDPM
    CP
    HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
    VENTTKKIFESGMIKGVPFLYHYKA

    >gi|308184177|ref|YP_003928310.1| copper-transporting ATPase [Helicobacter pylori SJM180]
    MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVNLLNKSANIEFNENETNLDEIFKLIEKLGYSPKKTLAEEKKEFFSP
    NVKLALAVIFTLFVVYLSMGAMLSPSLLPESLLTINNHSNFLNACLQLVGALIVMHWGRDFYIQGFKALWHRQPNMSSLI
    ALGTSAALISSLWQLYLVYANHYTDQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAMQALMKNAPKTALKMQNDQ
    QIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESMLSGEALPVYKKVGDKVFSGTLNSHTSFLMKATQNNKNSTL
    SQIVEMIHNAQSSKAEISRLADKVSSVFVPSVIAIAVLAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALGLATP
    MSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSNIELLELLSLASSIEKSSEHVIAKGIVE
    YAKERNAPLKEMSEVKVKTGFGISAKTDYQGAKEVIKVGNGEFFNPINALEIQENGILVFVGRVINEKEDELLGAFVLED
    LPKKGVKEHIAQIKNLGINTFLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMMVGDGLNDAPSLA
    MSDVAVVMAKGSDVSVQVADIVSFNNDIKSVYSAIKLSQATIKNIKENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAG
    LAMSLSSVSVVLNSQRLRNFKIKDH

    >gi|308184465|ref|YP_003928598.1| methylated-DNA--protein-cysteine methyltransferase [Helicobacter pylori SJM180]
    MTLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDAANFSHHTPMNTPLKLSVQALERYFLGQLFEFNAPLDLIGTFFQKQ
    VWSALLTIPYGKTKSYDEIAKLINNPKSCRAVGNANHNNPISLIVP
    CHRVVRKNGALGGYNGGIEVKKWLLEFESKILNE
    QAKNSLIS

    >gi|308184540|ref|YP_003928673.1| hypothetical protein HPSJM_03830 [Helicobacter pylori SJM180]
    MSEPIDRFTRIRWLFKNDFEKIRQQRVLICGVGGVGGFALDALYRVGIGQITIIDKDVFDVTNQNRQIGSERIGESKVLV
    LQDLYKGIQALNYRIDEAFLNSFNFRDYDYILDCMDDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESY
    GDKFGRKFRDFLKKRRFKGDFKVVFSPEVPH
    CIELGSFNAVTASFGLQIASEVVQDIIKNERQWNERLRRRIGRF

    >gi|308184575|ref|YP_003928708.1| cadmium-transporting ATPase [Helicobacter pylori SJM180]
    MQEYHIHNLDCPDCAAKLERDLNKLDYVKKAQINFSTSKLFLDTSDFEKVKAFIKQNEPHLSLSFKEAAEKPLSFTPLIV
    TIAVFLGAILILHLEPSPFIEKAVFVVLALVYLVSGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
    FYSAGEFLQKLAIARSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLRINDIVVVKVGEKVPVDGVVIKGESLLDERALS
    GESMPVNVSERSKVLGGSLNLKAVLEIQVEKLYKDSSIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAVL
    PPLFSMGSFDEWIYRGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGTLTKGVFKV
    VDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKNDKHQHDIKNYEEVSGMGVKAQCHTDLIIAGNEKMLDQ
    FHIAHSPSKENGTIVHVAFNQTYVGYIVISDEIKDDAIECLRDLKAQGIENFCILSGDRKSATESIAQTLGCEYYASLLP
    EEKTSVFKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLVKVLAIAKKTKSIIWQN
    ILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMRAMRA

    >gi|308184609|ref|YP_003928742.1| thioredoxin [Helicobacter pylori SJM180]
    MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELASEYEGKAKICKVNTDEQEELSAKFGIRSIPTLLFTK
    DGEVVHQLVGVQTKVALKEQLNKLLG

    >gi|308184610|ref|YP_003928743.1| thioredoxin reductase [Helicobacter pylori SJM180]
    MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFIQPWQEQCFRFGLKHEMSA
    IQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEEAI
    YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNETRELIVPGFFIFVGYD
    VNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH

    >gi|308184802|ref|YP_003928935.1| thiol peroxidase [Helicobacter pylori SJM180]
    MQKVTFKEETYQLEGKTLKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQAGKLPSVSFS
    VISMDLPFSQGQICGTEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEA
    LLKVLK

    >gi|308184816|ref|YP_003928949.1| hypothetical protein HPSJM_05305 [Helicobacter pylori SJM180]
    MFSLSYVSKKFLSVLLLISLFLSACKSNNKEKLDENLLSSGSQSSKELNDERDNIDKKSYAGLEDVFLDNKSISPNDKYM
    LLVFGRNG
    CHYCERLKKDLKNVKELSDYVKEHFSAYYVNISYSKEHNFKVGDKDKNDEKEIKMSTEELAQIYAVQTTPTI
    VLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGKYQDTKNDEDFIKKLKAYIKYKTNLSKSKSN

    >gi|308184968|ref|YP_003929101.1| hypothetical protein HPSJM_06100 [Helicobacter pylori SJM180]
    MLEDYAISLEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLADFLAQHKDKKVLLHCRAGRRALDAAKSMHELG
    YTPYYLEGNVYDFEKYGFRMVYDDTSLSGKKN

    >gi|308185222|ref|YP_003929355.1| thioredoxin [Helicobacter pylori SJM180]
    MLEVINGKNYAEKIAHQAVVVNVGASWCPDCRKIEPIMENLAKTYKGKVEFFKISFDESQDLKESLGIRKIPTLIFYKNA
    KEVGERLVEPSSQKPIEDALKALL

    >gi|308185274|ref|YP_003929407.1| putative component of cation transport for cbb3-type oxidase [Helicobacter pylori SJM180]
    MKCSHCQLEFKESELFKETINHKELHFCCTGCARVYALLTDLNLESFYDKLNDSTLAPVTPQDPMNILELEQALEENNKS
    DFILNLLLEKTH
    CNACLWLNQKVLERLGGVKKVSVNFTTHHLQIVFDKSLNPKEIIQKIESLGYGAKIYNAKNYTLKAQK
    EQRSYLLTLSVGFFATMNLMFIAIAKYASYGSASYGSGMDKLMQRNLDLVSLFLSLLVLVVVGRFFIKGAFYGLKNGVLG
    MDLSVSFGALSAFVYSLYAMLVSQETYFEASSTILTLVFGSKFLELKARLFANEKCLALESHEIHSVIIVENGKQIEKHP
    KDVAIGSVVWVPSGAKIALDGVLLNNASVDASLISGEFKPLELGVNDPILGGYVNVGVPFSYQVSANFQNSRLSSLLETL
    KKSFLEKPLIESSANQIADIFSKAVLFLAFVSFLLWQFGLGGNFEKALMVCISVLVISCPCAFALATPIALVIGVFKNPL
    IVFKEALFLETLAKVKKIFIDKTGTLTQKEVLLKEKIIYEEFDGRLLKSLLKTREHLAHNAILKTLNGDEVNLEKIEFFA
    HGLKANHQNETLLVGSLKFLKSMGVDLKVKESANIMVGFAKNKTLCALFILEERLKNNAKEVVQALQNKGLELEILSGDN
    ESSVKECAKKLGISKYHAHLTPEDKAQIISSYKGVCAMMGDGNNDALALKQASVSLGFEKSALSKSACDILLLEEDLSLL
    KKAFDNAQKVYQVVLQNIVLSLIYNAILIPIAMLGYINPLIASLSMSASSLLVVLNSLRLKRS

    >gi|308185349|ref|YP_003929482.1| alkyl hydroperoxide reductase [Helicobacter pylori SJM180]
    MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQV
    HFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALL
    HFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL

    >gi|308184176|ref|YP_003928309.1| copper ion binding protein [Helicobacter pylori SJM180]
    MKATFQVPSITCSHCVDKIEKFVGEIEGVSFIDASVEKKSVVVEFDAPATQDLIKEALLDAGQEVI